Os01t0724500-01

Locus

Os01g0724500

Description

Similar to ABC transporter (PDR5-like) isolog (PDR1 ABC transporter).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR15

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 15

Oryzabase Gene Symbol Synonym(s)

OsABCG38, OsPDR15

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 38, pleiotropic drug resistance 15

Transcript Evidence

AK067653 (DDBJ, Best hit)

Protein Evidence

A2ZXE5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Full-length cDNA

J013112I11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0724500-01)

RiceXPro (AK067653)

Others

Oryzabase (12012)

KEGG (Os01t0724500-01)

Transcript

3306 bp

>Os01t0724500-01 Similar to ABC transporter (PDR5-like) isolog (PDR1 ABC transporter).
TTTGCTGATTTATCTTTAACTCTGGCAAGGCTCCCGGTATTCTACAAACATAGGGACTTC
CTGTTTTATAGGCCATGGACTTTTGCACTTCCAAATGTTCTCGTGAGAATCCCTAGCTCC
CTGTTTGAGTCGATAATTTGGGTTGCAATAACCTACTACACCATGGGGTTTGCCCCTGAA
GCTAGCAGGTTCTTCAAACACCTGCTTGTAGTCTTCATGCTTCAGCAGATGGCTGCAGGA
CTGTTCAGAGTCACCGCTGGGTTATGCAGGACTGTTGTGGTAACGAACACTGCAGGGTCT
CTTGCAGTTCTGATCATGTTTGTGCTTGGAGGATTCATCCTACCAAAAGATGCAATCCCT
AAATGGTGGGTGTGGGCTTACTGGTGTTCACCCCTTACTTATGCATACATTGCCTTTTCT
TCCAATGAAATGCATTCTCCAAGGTGGATGGACAAATTTGTACCTGATGGAAAGAGATTG
GGAGTGGCAGTTCTAGAAAATTCAGGTGTCTTCACCAATAAGGAATGGTACTGGATTGCA
ACTGGCGCCCTTCTAGGGTTCACCATTCTGTTCAACGTGTTATTCTCGCTATCACTTATG
TACCTGAACCGTAAGTAGCTACACTGTACTTAGTAATAACCTGTTATGAGTTGCATCTGA
CAACAGATTATTTCCTTAACTTCGCCGATTGGCCTTTTCAAGTGAGCAGGTAGTGCAATT
AGTATAGTATTACATATATAGTGCCTTTGTATGAATGTTCTCTGCAATTCCAAATATTGA
TTCATGTAGATATTGAAAATCTAAAACTTTTAACTTCATAAATTTAAAATCATAGATGCC
CAAATTATAAGATTGTATTCTGCAAGCCCAATTAAATTCTGGATTCTTGATTCCATTTTT
TATTTCTTTTACAGTTCTTGGGAAGTATTTCTTTCATTAGCACACTTCTTTTTTTAGATA
CTTCTCTCCAGCTATATACCTAAAAAGAATGTTTTGGTCATTTTGTCCTTTCTTATCAGC
TGTAAATAAATACATTTGATACGTATAATATATCCAATGTCTGTGATAAATAGGTATTGT
CCTTCAATTTCAATGACATATTTTTGACATTTTGTAACGGCCATTTATTCTATTCCTTGA
ATTAGCTGTTGGAAAACCACAATCCATCCTCCCTGAAGAAACCGATAGTCAGGAGAACAT
TCAGGAAGGAAAAAACAAGGCACATATAAAACAGATAATTACAGTTGAAACACCAGAACC
TGTATCCCCGAACTCAATTATCACCCTGGATAAGGTGATTCAACAATTGCGTGGATATTC
CGCAAACACTTCTGATAGGTCGCACTCATACATTAATGCTGCTGGCAGAACTGCTCCAGG
AAGAGGGATGGTTCTTCCATTTGAACCGCTCTACATGTCCTTTAATGAGATAAATTACTA
TGTTGATATGCCTTTGAGTCAGGGAGTAACTGCCGATAAGCTTCAACTGCTGTCAGGGAT
ATCTGGAGCTTTTCGACCTGGTGTTCTGACTGCTCTTATGGGTGTTAGTGGGGCTGGAAA
GACTACCCTCATGGATGTCTTATCTGGGAGAAAGACAGGTGGATATATTGAAGGGGAAAT
CTATATATCGGGTTACCCAAAGAACCAAGCAACATTTGCTAGAATATCAGGCTACTGTGA
GCAAAATGACATCCACTCCCCACAGATTACTGTAAGGGAGTCCCTACTTTTCTCTGCTTT
CCTGCGCCTGCCTAAGGAGGTCAATGATCAAGAAAAGAAGATCTTTGTGGATGAAGTTAT
GGAACTGGTTGAGCTTACTGGTCTGAAAGATGCTATTGTGGGCCTCCCTGGTGTGAATGG
GCTGTCAACAGAACAAAGAAAGAGGCTGACAATCGCTGTAGAGCTTGTGGCAAACCCCTC
AATTATCTTTATGGATGAACCAACTTCTGGTCTTGATGCAAGAGCGGCTGCTATTGTTAT
GAGAACTGTACGTAACACTGTCAATACTGGAAGAACCGTTGTATGCACTATTCATCAACC
AAGCATTGACATTTTTGAAGCTTTTGATGAGTTGTTGCTACTAAAAAGAGGAGGCCAGGT
TATATATTCTGGACCATTGGGTACAAATTCTCATAAAGTTGTTGAGTACTTTGAGGCAAT
TCCTGGAGTCCCAAAGATCGAAGAGAATCGCAACCCAGCTACATGGATGCTGGATGTAAG
CTCAGCTGCATCAGAAGTTCGATTGGAAATTGATTTTGCTGAATATTACAGGTCATCGAC
TATGCACCAGCGAACCAAAGCATTGGTAAAAGAACTGAGCAATCCACCTCCTGGTTCCGA
TGACCTCTACTTCCCTAGTCAATACTCGCAGAGCACCTTTAATCAGTTCAAGCTCTGCCT
CTGGAAACAATGGTGGACTTACTGGAGAAGCCCTGATTATAACCTTGTCAGGATTTTCTT
TGCATTATTTACTGCTTTAATGTTGGGGACTATATTTTGGAGGGTTGGTCACAAGATGGA
GAGTTCAAAAGATCTCTTGGTCATCATTGGATCAATGTATGCTGCCGTCTTGTTTGTTGG
TTTTGAGAATTCTGTAACTGTTCAACCCGTTGTTGCTGTGGAAAGGACTGTATTTTACAG
AGAGCGGGCAGCTGGAATGTACTCGGCTATACCATATGCTCTAGCTCAGGTTGTTGTGGA
GATACCGTATGTGTTCGTTGAGACTGTCATTTACACACTTATTGTCTACCCAATGATGTC
GTTCCAATGGACACCAGCAAAATTCTTCTGGTTCTTCTATGTTTCATTCTTCACCTTCCT
CTATTTCACTTACTATGGCATGATGAACGTCTCCGTATCACCAAACCTTCAGGTTGCTTC
CATATTGGGTGCTGCCTTTTACACCCTTTTCAATCTCTTTTCAGGATTCTTCATCCCAAG
ACCGAAAATCCCAAAATGGTGGGTTTGGTACTATTGGCTTTGTCCAGTGGCATGGACAGT
ATACGGCCTTATTGTGTCACAGTACGGAGATGTGGAGGATTTTATCACGGTCCCTGGACA
ATCTGATCAGCAAGTCAGACCTTTCATCAAGGACTATTTTGGCTATGACCCGGACTTCAT
GGGCGTCGTGGCTGCAGTGCTGGCTGGCTTTACTGTCTTCTTCGCTTTTACATATGCTTA
CTCCATCAGAACCTTAAATTTCCAGCAGAGATAGAAAATCCTGCCATGTATTGCTGTGTG
TTGCAGTTCACATGTAAGATGTAACGCTAGTTTTCACCCAGGTATATATTCTATCTTATT
GATTGC

CDS

618 bp

>Os01t0724500-01 Similar to ABC transporter (PDR5-like) isolog (PDR1 ABC transporter).
TTTGCTGATTTATCTTTAACTCTGGCAAGGCTCCCGGTATTCTACAAACATAGGGACTTC
CTGTTTTATAGGCCATGGACTTTTGCACTTCCAAATGTTCTCGTGAGAATCCCTAGCTCC
CTGTTTGAGTCGATAATTTGGGTTGCAATAACCTACTACACCATGGGGTTTGCCCCTGAA
GCTAGCAGGTTCTTCAAACACCTGCTTGTAGTCTTCATGCTTCAGCAGATGGCTGCAGGA
CTGTTCAGAGTCACCGCTGGGTTATGCAGGACTGTTGTGGTAACGAACACTGCAGGGTCT
CTTGCAGTTCTGATCATGTTTGTGCTTGGAGGATTCATCCTACCAAAAGATGCAATCCCT
AAATGGTGGGTGTGGGCTTACTGGTGTTCACCCCTTACTTATGCATACATTGCCTTTTCT
TCCAATGAAATGCATTCTCCAAGGTGGATGGACAAATTTGTACCTGATGGAAAGAGATTG
GGAGTGGCAGTTCTAGAAAATTCAGGTGTCTTCACCAATAAGGAATGGTACTGGATTGCA
ACTGGCGCCCTTCTAGGGTTCACCATTCTGTTCAACGTGTTATTCTCGCTATCACTTATG
TACCTGAACCGTAAGTAG

Protein

205 aa

>Os01t0724500-01 Similar to ABC transporter (PDR5-like) isolog (PDR1 ABC transporter).
FADLSLTLARLPVFYKHRDFLFYRPWTFALPNVLVRIPSSLFESIIWVAITYYTMGFAPE
ASRFFKHLLVVFMLQQMAAGLFRVTAGLCRTVVVTNTAGSLAVLIMFVLGGFILPKDAIP
KWWVWAYWCSPLTYAYIAFSSNEMHSPRWMDKFVPDGKRLGVAVLENSGVFTNKEWYWIA
TGALLGFTILFNVLFSLSLMYLNRK*

CDS

chr01:30217567..30217754 (+ strand) : 188 bp

chr01:30217856..30218016 (+ strand) : 161 bp

chr01:30218299..30218408 (+ strand) : 110 bp

chr01:30218495..30218653 (+ strand) : 159 bp

3'UTR

chr01:30218654..30219321 (+ strand) : 668 bp

chr01:30219431..30219600 (+ strand) : 170 bp

chr01:30220237..30220560 (+ strand) : 324 bp

chr01:30220724..30221014 (+ strand) : 291 bp

chr01:30221099..30221182 (+ strand) : 84 bp

chr01:30221363..30221496 (+ strand) : 134 bp

chr01:30221689..30221916 (+ strand) : 228 bp

chr01:30222016..30222187 (+ strand) : 172 bp

chr01:30222364..30222618 (+ strand) : 255 bp

chr01:30222706..30223067 (+ strand) : 362 bp

FASTA

>Os01t0724500-01 class=Sequence position=chr01:30217567..30223067 (+ strand)
TTTGCTGATT TATCTTTAAC TCTGGCAAGG CTCCCGGTAT TCTACAAACA TAGGGACTTC CTGTTTTATA GGCCATGGAC
TTTTGCACTT CCAAATGTTC TCGTGAGAAT CCCTAGCTCC CTGTTTGAGT CGATAATTTG GGTTGCAATA ACCTACTACA
CCATGGGGTT TGCCCCTGAA GCTAGCAGGT GCTCCTTCTG AGTGATTCAA ATCTACTAAA GTTCTATACC ATTTCGAATT
TATATGATTT CTCTCTGCCC TTAACATCCC GATGTTCATC TTGCCTTAGG TTCTTCAAAC ACCTGCTTGT AGTCTTCATG
CTTCAGCAGA TGGCTGCAGG ACTGTTCAGA GTCACCGCTG GGTTATGCAG GACTGTTGTG GTAACGAACA CTGCAGGGTC
TCTTGCAGTT CTGATCATGT TTGTGCTTGG AGGATTCATC CTACCAAAAG GTAGCCGCTC ATATTTTCAG ACACATATGG
TTGTCCTTGC AATGGTACCA TGGGTATAAG GAGATGTGGT GATTCTTAAA AATCAGAAAA GGGAGATACC TTTTGAAATG
AAACACAAAT ATTAGTACTC TTGCTGCAAA GAACATTTTA GTAACTTTTT TATAGTGGAC ACTTGTCAAT GTTTAATATT
GAGGTGGCTG TTGAAATGAT CACTGTAAAT TAGAATATTA GTCATTTCAC GTGTTACTTG AATTTGAACC ATTCAAATTA
TGATTGTTAC AGATGCAATC CCTAAATGGT GGGTGTGGGC TTACTGGTGT TCACCCCTTA CTTATGCATA CATTGCCTTT
TCTTCCAATG AAATGCATTC TCCAAGGTGG ATGGACAAAT TTGTAAGTTG ACTCTTGATC ATCTTATTAT TCTGTTCCTG
CAGGTAATAG TGGTTCTTGT CTTCTTGACT TTCTGATTGT GTATCAAGGT ACCTGATGGA AAGAGATTGG GAGTGGCAGT
TCTAGAAAAT TCAGGTGTCT TCACCAATAA GGAATGGTAC TGGATTGCAA CTGGCGCCCT TCTAGGGTTC ACCATTCTGT
TCAACGTGTT ATTCTCGCTA TCACTTATGT ACCTGAACCG TAAGTAGCTA CACTGTACTT AGTAATAACC TGTTATGAGT
TGCATCTGAC AACAGATTAT TTCCTTAACT TCGCCGATTG GCCTTTTCAA GTGAGCAGGT AGTGCAATTA GTATAGTATT
ACATATATAG TGCCTTTGTA TGAATGTTCT CTGCAATTCC AAATATTGAT TCATGTAGAT ATTGAAAATC TAAAACTTTT
AACTTCATAA ATTTAAAATC ATAGATGCCC AAATTATAAG ATTGTATTCT GCAAGCCCAA TTAAATTCTG GATTCTTGAT
TCCATTTTTT ATTTCTTTTA CAGTTCTTGG GAAGTATTTC TTTCATTAGC ACACTTCTTT TTTTAGATAC TTCTCTCCAG
CTATATACCT AAAAAGAATG TTTTGGTCAT TTTGTCCTTT CTTATCAGCT GTAAATAAAT ACATTTGATA CGTATAATAT
ATCCAATGTC TGTGATAAAT AGGTATTGTC CTTCAATTTC AATGACATAT TTTTGACATT TTGTAACGGC CATTTATTCT
ATTCCTTGAA TTAGCTGTTG GAAAACCACA ATCCATCCTC CCTGAAGAAA CCGATAGTCA GGAGAACATT CAGGAAGGAA
AAAACAAGGC ACATATAAAA CAGATAATTA CAGTTGAAAC ACCAGAACCT GTATCCCCGA ACTCAATTAT CACCCGTAAG
CATATTTCTG ATTTGTCATC ATATTCTCTC TTCCTCATGT TCTCATAAAT ATACCTTTTT GTCATTAGCA CTCTCTCTGA
AATGATGTTT TCAACTGTTT CTAGTGGATA AGGTGATTCA ACAATTGCGT GGATATTCCG CAAACACTTC TGATAGGTCG
CACTCATACA TTAATGCTGC TGGCAGAACT GCTCCAGGAA GAGGGATGGT TCTTCCATTT GAACCGCTCT ACATGTCCTT
TAATGAGATA AATTACTATG TTGATATGCC TTTGGTGTGT ATGTTTATCC CTATTCATTG TTCTTCCTTT TCTGACCTGC
ATTTCCGTTT CATATAGTTA TTGTGACCAC GGACATTCCA TATCATGCAA TAACTAAAAC CTTTGTTTAC ATTTGGATTT
CTTATTCTTT AATACTGGCT TCTTGGAGAA ACACCTCCTC GCATTGTATC CTTGAGCTTA TCAGCTAATG CTTGAGTGTA
GTtactacct ctgtttcata ttgtaaggcg ttttagttgt cgtaagtcaa acttctttag ctttgactaa gtttgtagaa
aaatgtacta acatcttcaa catcaaatta attcattaaa tccacagtga aatatgtatt tataacatat ttatttggta
ttgtagatgt taatatattt ttctataaac ttggtcaaag ttagggaatt ttgacttatg acgaaactca aacaccttac
aatatggaat agggggagta GTAGTTTGTA GAGGTTTGGT GTTGCGAGTT AACATATTTT TATGCTACTG TTTTTTGAGT
GTGCAGGATA CATATATTCC TGAACTCAAA CTTTTCATGT GGTGTAGTGA CGTTAATTTT CATAACCTGT AATCTTATTT
TCCAAACTGT GAATATGTCA GGAAATGAAG AGTCAGGGAG TAACTGCCGA TAAGCTTCAA CTGCTGTCAG GGATATCTGG
AGCTTTTCGA CCTGGTGTTC TGACTGCTCT TATGGGTGTT AGTGGGGCTG GAAAGACTAC CCTCATGGAT GTCTTATCTG
GGAGAAAGAC AGGTGGATAT ATTGAAGGGG AAATCTATAT ATCGGGTTAC CCAAAGAACC AAGCAACATT TGCTAGAATA
TCAGGCTACT GTGAGCAAAA TGACATCCAC TCCCCACAGA TTACTGTAAG GGAGTCCCTA CTTTTCTCTG CTTTCCTGCG
CCTGCCTAAG GAGGTCAATG ATCAAGAAAA GAAGGTTTGT TCTTGTGTTA TGCCCTTCTT ACAATATCAA CTATCAACTT
GTGTCAATAT GCAGTGAGTT TTATGCTACT AACTTTACTG CGATAAAATC TTGAATGAAC ATTTCCTTTT TTTAATGAGG
GATGGATAAG TTGATTAAGG TGGACCTTTG TATGTAGATC TTTGTGGATG AAGTTATGGA ACTGGTTGAG CTTACTGGTC
TGAAAGATGC TATTGTGGGC CTCCCTGGTG TGAATGGGCT GTCAACAGAA CAAAGAAAGA GGCTGACAAT CGCTGTAGAG
CTTGTGGCAA ACCCCTCAAT TATCTTTATG GATGAACCAA CTTCTGGTCT TGATGCAAGA GCGGCTGCTA TTGTTATGAG
AACTGTACGT AACACTGTCA ATACTGGAAG AACCGTTGTA TGCACTATTC ATCAACCAAG CATTGACATT TTTGAAGCTT
TTGATGAGGT ATAGTCTACT GTATACATTA TTTTCAAAAT TACTGCTTTA CTGCTCTTTG TTAATTGAAG ATCTTGATTT
TTCACCATGC AGTTGTTGCT ACTAAAAAGA GGAGGCCAGG TTATATATTC TGGACCATTG GGTACAAATT CTCATAAAGT
TGTTGAGTAC TTTGAGGTTT GTGGTCTGAC ACCCAAACTA TTTCACTTAT CCCCATAGCT TAAATTCCCC TATAATCTTG
TGGTGGTACC TTGTAAGAGA CTCTGCAATT ACATGTATAT GATATGATTT CAAGTTCCTT CTTTGTGAAG CCTGCATCTC
GAAATGTTCA TTTTTTTGCC CGCTTTATCA AACTAGGCAA TTCCTGGAGT CCCAAAGATC GAAGAGAATC GCAACCCAGC
TACATGGATG CTGGATGTAA GCTCAGCTGC ATCAGAAGTT CGATTGGAAA TTGATTTTGC TGAATATTAC AGGTCATCGA
CTATGCACCA GTAAGTGCAG TGTTCTTTCC ACAATTCAAT TTCTTCCAGG AGTGGAGGCA GCATTATATT GTTAGCATGC
ACTGTCAACC TTGAAGTTTA GATCATGCAA TTGAAGCAAA AAATGGGCTT ACTCTCTTGC ATCTTTAACT CTTAAGGCAT
TTAGATAACT GCGACCTTTT TTCTATGGCT AATTATTTTC AGGCGAACCA AAGCATTGGT AAAAGAACTG AGCAATCCAC
CTCCTGGTTC CGATGACCTC TACTTCCCTA GTCAATACTC GCAGAGCACC TTTAATCAGT TCAAGCTCTG CCTCTGGAAA
CAATGGTGGA CTTACTGGAG AAGCCCTGAT TATAACCTTG TCAGGATTTT CTTTGCATTA TTTACTGCTT TAATGTTGGG
GACTATATTT TGGAGGGTTG GTCACAAGAT GTATGTACTT TTATCAGGCT AAGTTATTAT CCGCAGAGTC ATTGAATATT
TTCATGAATA CCTATCACTG GTTCCTTAAA TGTTTCTTAT TTGATGCAGG GAGAGTTCAA AAGATCTCTT GGTCATCATT
GGATCAATGT ATGCTGCCGT CTTGTTTGTT GGTTTTGAGA ATTCTGTAAC TGTTCAACCC GTTGTTGCTG TGGAAAGGAC
TGTATTTTAC AGAGAGCGGG CAGCTGGAAT GTACTCGGCT ATACCATATG CTCTAGCTCA GGTCAGTGAT ATTACTTTGT
ATCTCAACTG AACCCAGAAC ACCTTAAAAA TGTCAGACCA ATGGAATATT ATGGAAACTT TGCAACAGAA GGTCACAATC
ATGTAGTAGA AATGAGATAT AAATTCATTT CAATATATAA GTAACTTTTT ATAATCAATC TGTTGAATTT TTGTCAGGTT
GTTGTGGAGA TACCGTATGT GTTCGTTGAG ACTGTCATTT ACACACTTAT TGTCTACCCA ATGATGTCGT TCCAATGGAC
ACCAGCAAAA TTCTTCTGGT TCTTCTATGT TTCATTCTTC ACCTTCCTCT ATTTCACTTA CTATGGCATG ATGAACGTCT
CCGTATCACC AAACCTTCAG GTTGCTTCCA TATTGGGTGC TGCCTTTTAC ACCCTTTTCA ATCTCTTTTC AGGATTCTTC
ATCCCAAGAC CGGTAAGTCC CTTAATTGTC TATATTTAAG CTCTAAACCT TTTTCTGTAC AATTTCTGTA GGTTGATCTG
GTTTTGTATG TTTCTGCAGA AAATCCCAAA ATGGTGGGTT TGGTACTATT GGCTTTGTCC AGTGGCATGG ACAGTATACG
GCCTTATTGT GTCACAGTAC GGAGATGTGG AGGATTTTAT CACGGTCCCT GGACAATCTG ATCAGCAAGT CAGACCTTTC
ATCAAGGACT ATTTTGGCTA TGACCCGGAC TTCATGGGCG TCGTGGCTGC AGTGCTGGCT GGCTTTACTG TCTTCTTCGC
TTTTACATAT GCTTACTCCA TCAGAACCTT AAATTTCCAG CAGAGATAGA AAATCCTGCC ATGTATTGCT GTGTGTTGCA
GTTCACATGT AAGATGTAAC GCTAGTTTTC ACCCAGGTAT ATATTCTATC TTATTGATTG C

Locus: Os01g0724500

Loading...

Locus: Os01g0724500

Loading...