Os01t0726400-01

Locus

Os01g0726400

Description

MADS box transcription factor, Regulation of floral organ identity

RAP-DB Gene Symbol Synonym(s)

MADS32, OsMADS32, CFO1, CFO1/OsMADS32, TRI1

RAP-DB Gene Name Synonym(s)

MADS BOX GENE 32, MADS box gene32, MADS-box transcription factor 32, CHIMERIC FLORAL ORGANS 1, triangular hull 1

CGSNL Gene Symbol

MADS32

CGSNL Gene Name

MADS BOX GENE 32

Oryzabase Gene Symbol Synonym(s)

OsMADS32, CFO1, CFO1/OsMADS32, TRI1, OsMADS32/CFO, CFO

Oryzabase Gene Name Synonym(s)

MADS box gene32, MADS-box transcription factor 32, CHIMERIC FLORAL ORGANS 1, triangular hull 1

Transcript Evidence

HQ711850 (indica, 14bp deletion)

AY177699 (Dongjin)

Protein Evidence

Q8S151

A2WUN4

Literature

PMID: 22891238

Note

Manual Curation

July 20, 2014

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein dimerization activity (GO:0046983)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor, MADS-box (IPR002100)

Transcription factor, K-box (IPR002487)

Expression Databases

TENOR (Os01t0726400-00)

Others

Oryzabase (3097)

Transcript

684 bp

>Os01t0726400-01 MADS box transcription factor, Regulation of floral organ identity
ATGGGGAGGGGGCGCAGCGAGATAAAGAGGATAGAGAACCCCACGCAGCGGCAGTCCACC
TTCTACAAGCGCAGGGACGGCCTGTTCAAGAAGGCCAGGGAGCTCGCCGTCCTCTGCGAC
GCCGACCTCCTCCTCCTCCTCTTCTCCGCCTCCGGCAAGCTCTACCACTTCCTCTCCCCC
ACCGTCCCCTCCGTGAGGGAGTTTGTCGAGAGGTACGAGGCCACCACGCACACCAAGGTT
TGGGCAGATATCAGGCAGGAGAGGCGCGCCGAGCTGGAGAAGGTGGGCAGCATGTGCGAC
CTCCTGGAGAAACAGCTGAGGTTCATGACGGTGGACGACGGCGAGGAGTACACGGTGCCG
TCGCTGGAGGCGCTGGAGCACAATCTGGAGGCCGCCATGCGCAAGGTGCGCTCCGAGAAG
GACCGCAAGATCGGAGGCGAGATCTGCTACCTCCAGAACATTATTAGGGGGCGACAAGAG
GAGCGGTACGGGCTGTGCGACAAGATTGCTCATGCACAGACTCTGAAGGATGTGGAATGT
GGATCCACCTCACTAAGCAATGGCTTGGACCTTAAACTGGGGTTCAACTAGAAACAGATG
GACGCTTGACGTTCAGATTTCCTTTATTGCTGCTTAGAGCCAGTGTTCTATTATGAAAGA
TTATGCTGAACTTTTCCGGGGTTA

CDS

591 bp

>Os01t0726400-01 MADS box transcription factor, Regulation of floral organ identity
ATGGGGAGGGGGCGCAGCGAGATAAAGAGGATAGAGAACCCCACGCAGCGGCAGTCCACC
TTCTACAAGCGCAGGGACGGCCTGTTCAAGAAGGCCAGGGAGCTCGCCGTCCTCTGCGAC
GCCGACCTCCTCCTCCTCCTCTTCTCCGCCTCCGGCAAGCTCTACCACTTCCTCTCCCCC
ACCGTCCCCTCCGTGAGGGAGTTTGTCGAGAGGTACGAGGCCACCACGCACACCAAGGTT
TGGGCAGATATCAGGCAGGAGAGGCGCGCCGAGCTGGAGAAGGTGGGCAGCATGTGCGAC
CTCCTGGAGAAACAGCTGAGGTTCATGACGGTGGACGACGGCGAGGAGTACACGGTGCCG
TCGCTGGAGGCGCTGGAGCACAATCTGGAGGCCGCCATGCGCAAGGTGCGCTCCGAGAAG
GACCGCAAGATCGGAGGCGAGATCTGCTACCTCCAGAACATTATTAGGGGGCGACAAGAG
GAGCGGTACGGGCTGTGCGACAAGATTGCTCATGCACAGACTCTGAAGGATGTGGAATGT
GGATCCACCTCACTAAGCAATGGCTTGGACCTTAAACTGGGGTTCAACTAG

Protein

197 aa

>Os01t0726400-01 MADS box transcription factor, Regulation of floral organ identity
MGRGRSEIKRIENPTQRQSTFYKRRDGLFKKARELAVLCDADLLLLLFSASGKLYHFLSP
TVPSVREFVERYEATTHTKVWADIRQERRAELEKVGSMCDLLEKQLRFMTVDDGEEYTVP
SLEALEHNLEAAMRKVRSEKDRKIGGEICYLQNIIRGRQEERYGLCDKIAHAQTLKDVEC
GSTSLSNGLDLKLGFN*

CDS

chr01:30280387..30280577 (- strand) : 191 bp

chr01:30280203..30280269 (- strand) : 67 bp

chr01:30280021..30280082 (- strand) : 62 bp

chr01:30279808..30279949 (- strand) : 142 bp

chr01:30279621..30279662 (- strand) : 42 bp

chr01:30278590..30278665 (- strand) : 76 bp

chr01:30278492..30278502 (- strand) : 11 bp

3'UTR

chr01:30278399..30278491 (- strand) : 93 bp

FASTA

>Os01t0726400-01 class=Sequence position=chr01:30278399..30280577 (- strand)
ATGGGGAGGG GGCGCAGCGA GATAAAGAGG ATAGAGAACC CCACGCAGCG GCAGTCCACC TTCTACAAGC GCAGGGACGG
CCTGTTCAAG AAGGCCAGGG AGCTCGCCGT CCTCTGCGAC GCCGACCTCC TCCTCCTCCT CTTCTCCGCC TCCGGCAAGC
TCTACCACTT CCTCTCCCCC ACCGTCCCCT CGTAAGCTGC CCTGCCACAC ATCCGCTTGT CGATCCGTCA CGTATGTATA
TGCGCGCGCG CTGTCTCCTG ACATTGTTGG TTAATCCACG TTTCGTTGCT GCTTCTTTCT TGGCGCAGCG TGAGGGAGTT
TGTCGAGAGG TACGAGGCCA CCACGCACAC CAAGGTTTGG GCAGATATCA GGCAGGTACG TAGCACGTAG TACAACGCAA
CGCGCGTAGT AATCAGTTGT TTGAGCGTTT TCTCACCAGT AAATAAACGT GCGCCGTTTT TTTTTTCTCT TCCTTGGCAC
CGCGCATGCA TGTAGGAGAG GCGCGCCGAG CTGGAGAAGG TGGGCAGCAT GTGCGACCTC CTGGAGAAAC AGCTGAGGTA
AGCAACTCGA TGCGAGCTGA TCGATGTCAC TCGTCATGAT ATCGTGTGTG CTTTTGTGTT TTTGGCAGGT TCATGACGGT
GGACGACGGC GAGGAGTACA CGGTGCCGTC GCTGGAGGCG CTGGAGCACA ATCTGGAGGC CGCCATGCGC AAGGTGCGCT
CCGAGAAGGA CCGCAAGATC GGAGGCGAGA TCTGCTACCT CCAGAACATT GTACGTCTTT CGTAAACACG GCCCACTTCT
GATACGATTC ATACCTGTGC CGTCAGGACA CTTGTACAGA TTTACAGATT GCGTTGTGAA CCGAGACCAA ACATCACTAG
TAATATACAT GTGTTTTTCG ATTATCTGCG TGCAGATTAG GGGGCGACAA GAGGAGCGGT ACGGGCTGTG CGACAAGGTA
AAGAATATAA TCATTCTGGC TATTTATCAA GTTGTACTAT CTTCGTTTGT TAGTCAGTTC ATTATCATCG TCATCATCAA
TTTTCCCTTT CAAATGGTCA AAAAGAAATC TTGTGTAAAT GTTCTTCATA GGCAAATGTT GACAGATGAT AGGCAAACAC
TCGTGAGAAA CATAGCACTT GGCAGCAATT TCATATAAGT ATTGAACCCA CAAGTGCAAA GAAAGACATT GATCCAAACA
GGTAGCTAAG TTCTTTGGTG TTCTTGGTCC TGTAGTTTTG CCTTCAGATC TTAATTCATC TCTAAATTAG AGATAAATAA
GCAAATACTA GCCTATAAGA ATGGTTAGCT GAGAAATCAT TGGTTTATTT TAGTTGACGG ATCAAGATAC ATAGCTTTCC
CTCCAAAAAT AAAAATAAGA CAGAAAATAG ATCGAAAAAC CATGGTAGAT TTGTTTTAAA TTTATTCCCC TTTTGTTGCT
GTGCCTGGAT ATTTGGTTCT TTTTTTCAGA CTATAGGATA CAGTATAAAG ATAGACGCAA GTATAGGACT ATAGAAGCAC
CATTCAGAGG AAGCGTGCAT GCCCTACTCA TGGTACTACA TACACAGGCA CAGTAGACCG ATGCTAGACA AGAGCAATGC
TCCATTACAA GGCATAAAGA GACACAAAGT ATACTAACCT AGAACATATA GACCCTTTCA TGGAACCCCT TTACCATGGA
AGTGGAATAG CTTTCAGTTC GTGAAAGCAA CTGCATCAAC CTACATGAAA CTATGCAGGG TAGCTCATGA AGCCTACCTA
CAGTGGCCGC TAGTAGCTTA CTATTGGGTT ACGTGGGTAG AGAAAGTGAC CAAAACTTTT TGTTTGATTT CTCAAACCCT
CCTTTTTGTT TCTTTCTGAG ATTTTGAAAT GCTTCAGTAT TTTAGATGTT GCTCTGTAAT TTTCCTGCAC AGATTGCTCA
TGCACAGACT CTGAAGGATG TGGAATGTGG ATCCACCTCA CTAAGCAATG GCTTGGACCT TAAACTGGGT TAGTCATACG
ACTGAATCAT GTACCTTATG TATGAATTGG GTGATCCGAT TGTATTTGTA CCTTACAAAC CTCGGTATTA TGCAGGGTTC
AACTAGAAAC AGATGGACGC TTGACGTTCA GATTTCCTTT ATTGCTGCTT AGAGCCAGTG TTCTATTATG AAAGATTATG
CTGAACTTTT CCGGGGTTA

Locus: Os01g0726400

Loading...

Locus: Os01g0726400

Loading...