Os01t0741200-01

Locus

Os01g0741200

Description

Similar to LysM type receptor kinase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLysM-RLK4

Oryzabase Gene Name Synonym(s)

LysM receptor-like kinase 4

Transcript Evidence

AK073720 (DDBJ, Best hit)

Protein Evidence

D3P8G9 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J033063N13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0741200-01)

Others

Oryzabase (10923)

Transcript

1537 bp

>Os01t0741200-01 Similar to LysM type receptor kinase (Fragment).
TATGGATGGGTTATTGGCAGCATGGGAGTTGCACTTGCTTTGATTGCTATTGCTCTCCTT
GCACTTGTTCTGTGCAAGCTCTCCCAATACAATCCCCAAGCTCCAAATAACCAGGGAAAG
AGCCCAGACCAGTCTATATCACACAAGTTTCAACTTCTTAAGAGTGGTAGTTTTTGTTAT
GGTTCTGGAAGATACTTATGTTGCCAATTTGGAAATGTGAAACAATCAAGAACGGATGGC
AGTGATCATCATATGAATACCCCAAAAGGTGTTGTAGTGGACGTGTTTGATAGGGAGAAG
CCCATTGTGTTTACCTATCAAGAAATACTTGCATCAACCGATTCATTTTCTGATGCAAAT
CTTCTGGGTCATGGTACATATGGCTCTGTTTATTATGGTGTTCTTCGAGACCAGGAGGTC
GCTATAAAGAGAATGACAGCAACTAAAACTAAAGAGTTTATAGTGGAGATGAAAGTTCTT
TGTAAGGTCCATCATGCCAGTCTGGTAGAGTTGATTGGCTATGCAGCAAGCAAGGATGAA
CTATACCTTATTTACGAGTACTCTCAAAAAGGTTCACTCAAGAATCACCTTCATGATCCT
CAAAGCAAAGGTTACACATCATTGTCTTGGATCTACAGGGTCCAAATTGCTCTTGATGCG
GCTAGAGGACTTGAATACATTCATGAGCATACAAAGGATCATTATGTTCACAGGGACATC
AAATCGAGTAACATCTTGCTCGATGAATCCTTCAGAGCAAAGATTTCAGATTTTGGTCTT
GCAAAACTGGTAGTGAAGTCAACTGATGCAGAGGCTTCTGTCACAAAAGTTGTGGGTACA
TTTGGTTACTTGGCCCCTGAATACTTGCGCGATGGCCTGGCAACTACGAAAAATGATGTT
TATGCTTTTGGAGTAGTACTTTTTGAGTTAATATCTGGAAAGGAGGCAATTACAAGGACT
GATGGATTGAACGAAGGATCAAACTCAGAAAGGCGTTCCTTGGCATCAGTTATGTTGAGT
GCACTAAAGAATTGTCGTAACTCAATGTATATGGGGAGCCTGAAAGACTGCATTGACCCT
AATCTAATGGACCTGTATCCACATGACTGTGTATACAAGATGGCCATGCTAGCGAAACAG
TGCGTGGAGGAAGATCCTGTTCTTCGGCCAGACATGAAGCAGGCAGTAATCACGCTATCG
CAAATACTGCTGTCGTCGATCGAGTGGGAAGCGACGCTAGCTGGGAACAGCCAAGTGTTC
AGTGGTCTTGTGGCTGGGAGGTGATCCTGTAAGATTGGCCTGGTTGCTACGGTGCTATCC
CATGCGCTCTTCGGTGATCTCCTTCCCTGCTCCACTAGAGGCGTTTTCCCCTGTAACCTT
CTCCTGCATTTTGCTGGTTTCTTGCCCAGTTGAGCAGTTTTCTGCATCTTCTTTTCAAAG
TATCTACCACAGTGCAATATATTTCTTGGTGGGTGATATGTAACCATGTATGTATACCAA
ATGTGCCTTGCAAGTTCTAATGCAATGATCTTGCACC

CDS

1284 bp

>Os01t0741200-01 Similar to LysM type receptor kinase (Fragment).
TATGGATGGGTTATTGGCAGCATGGGAGTTGCACTTGCTTTGATTGCTATTGCTCTCCTT
GCACTTGTTCTGTGCAAGCTCTCCCAATACAATCCCCAAGCTCCAAATAACCAGGGAAAG
AGCCCAGACCAGTCTATATCACACAAGTTTCAACTTCTTAAGAGTGGTAGTTTTTGTTAT
GGTTCTGGAAGATACTTATGTTGCCAATTTGGAAATGTGAAACAATCAAGAACGGATGGC
AGTGATCATCATATGAATACCCCAAAAGGTGTTGTAGTGGACGTGTTTGATAGGGAGAAG
CCCATTGTGTTTACCTATCAAGAAATACTTGCATCAACCGATTCATTTTCTGATGCAAAT
CTTCTGGGTCATGGTACATATGGCTCTGTTTATTATGGTGTTCTTCGAGACCAGGAGGTC
GCTATAAAGAGAATGACAGCAACTAAAACTAAAGAGTTTATAGTGGAGATGAAAGTTCTT
TGTAAGGTCCATCATGCCAGTCTGGTAGAGTTGATTGGCTATGCAGCAAGCAAGGATGAA
CTATACCTTATTTACGAGTACTCTCAAAAAGGTTCACTCAAGAATCACCTTCATGATCCT
CAAAGCAAAGGTTACACATCATTGTCTTGGATCTACAGGGTCCAAATTGCTCTTGATGCG
GCTAGAGGACTTGAATACATTCATGAGCATACAAAGGATCATTATGTTCACAGGGACATC
AAATCGAGTAACATCTTGCTCGATGAATCCTTCAGAGCAAAGATTTCAGATTTTGGTCTT
GCAAAACTGGTAGTGAAGTCAACTGATGCAGAGGCTTCTGTCACAAAAGTTGTGGGTACA
TTTGGTTACTTGGCCCCTGAATACTTGCGCGATGGCCTGGCAACTACGAAAAATGATGTT
TATGCTTTTGGAGTAGTACTTTTTGAGTTAATATCTGGAAAGGAGGCAATTACAAGGACT
GATGGATTGAACGAAGGATCAAACTCAGAAAGGCGTTCCTTGGCATCAGTTATGTTGAGT
GCACTAAAGAATTGTCGTAACTCAATGTATATGGGGAGCCTGAAAGACTGCATTGACCCT
AATCTAATGGACCTGTATCCACATGACTGTGTATACAAGATGGCCATGCTAGCGAAACAG
TGCGTGGAGGAAGATCCTGTTCTTCGGCCAGACATGAAGCAGGCAGTAATCACGCTATCG
CAAATACTGCTGTCGTCGATCGAGTGGGAAGCGACGCTAGCTGGGAACAGCCAAGTGTTC
AGTGGTCTTGTGGCTGGGAGGTGA

Protein

428 aa

>Os01t0741200-01 Similar to LysM type receptor kinase (Fragment).
YGWVIGSMGVALALIAIALLALVLCKLSQYNPQAPNNQGKSPDQSISHKFQLLKSGSFCY
GSGRYLCCQFGNVKQSRTDGSDHHMNTPKGVVVDVFDREKPIVFTYQEILASTDSFSDAN
LLGHGTYGSVYYGVLRDQEVAIKRMTATKTKEFIVEMKVLCKVHHASLVELIGYAASKDE
LYLIYEYSQKGSLKNHLHDPQSKGYTSLSWIYRVQIALDAARGLEYIHEHTKDHYVHRDI
KSSNILLDESFRAKISDFGLAKLVVKSTDAEASVTKVVGTFGYLAPEYLRDGLATTKNDV
YAFGVVLFELISGKEAITRTDGLNEGSNSERRSLASVMLSALKNCRNSMYMGSLKDCIDP
NLMDLYPHDCVYKMAMLAKQCVEEDPVLRPDMKQAVITLSQILLSSIEWEATLAGNSQVF
SGLVAGR*

CDS

chr01:30952138..30952405 (- strand) : 268 bp

chr01:30951410..30951555 (- strand) : 146 bp

chr01:30951241..30951330 (- strand) : 90 bp

chr01:30951040..30951145 (- strand) : 106 bp

chr01:30950611..30950762 (- strand) : 152 bp

chr01:30950425..30950522 (- strand) : 98 bp

chr01:30950190..30950340 (- strand) : 151 bp

chr01:30949901..30950008 (- strand) : 108 bp

chr01:30949632..30949796 (- strand) : 165 bp

3'UTR

chr01:30949379..30949631 (- strand) : 253 bp

FASTA

>Os01t0741200-01 class=Sequence position=chr01:30949379..30952405 (- strand)
TATGGATGGG TTATTGGCAG CATGGGAGTT GCACTTGCTT TGATTGCTAT TGCTCTCCTT GCACTTGTTC TGTGCAAGCT
CTCCCAATAC AATCCCCAAG CTCCAAATAA CCAGGGAAAG AGCCCAGACC AGTCTATATC ACACAAGTTT CAACTTCTTA
AGAGTGGTAG TTTTTGTTAT GGTTCTGGAA GATACTTATG TTGCCAATTT GGAAATGTGA AACAATCAAG AACGGATGGC
AGTGATCATC ATATGAATAC CCCAAAAGGT TAGTTCATCT CCTTTTAACC ATCATTGTGC TGCATAACAT GTTTTTTTTG
TATATATATG ATGGGAATAA TTCCTGGCCA CTGCATCTGC ACAGCACGGC AATGCAGTGG TGAATGGGTT TTGCTGAGTT
CATTTTGCGT GGATATTAAT ATAGGAGTGG CCTGATGAAT CTAGTGCCTT ATATAGGCAT ATTAAAGATC GAAATGTTGT
CATATGCATA TCCCTTAGGG GTTTTGTTTT TTCAAAATGT TATATTGTCA TTGCATATGA CACTCATGTC AGCATCGCTT
AGTTGCTTTT CCTGCAATGA TTTAAGCAGG AATACGATCT GTTCAAATTT TTGTATGAGT TCAAGTAGCA CCAAACACAT
CTGATGATCT GAACTTCTAT ACTGAAGTAC ATTGTCCAAA TAATATCAAA GAAAACAAAA CGTCAAGATA CAAATTCACA
ACTAAACAAC TTCATGATTT CTTAGTGTGA CAAGCCATTT CTAGCAGCCT AGAACGCTCT GCTTTGATTT GTTCTAATTT
TCTTTCGTTC CTCTCACATA CAAGCTGTTC TCAATTTTCC TCTCATGCAG GTGTTGTAGT GGACGTGTTT GATAGGGAGA
AGCCCATTGT GTTTACCTAT CAAGAAATAC TTGCATCAAC CGATTCATTT TCTGATGCAA ATCTTCTGGG TCATGGTACA
TATGGCTCTG TTTATTATGG TGTTCTTCGA GACCAGGTAT GTGATCTGAG CTGACCATAT CCATGCAAAA CTGTTGTGAT
TTTCCCTTGC CAATAACAAA TATGTTTTTT CATAGGAGGT CGCTATAAAG AGAATGACAG CAACTAAAAC TAAAGAGTTT
ATAGTGGAGA TGAAAGTTCT TTGTAAGGTC CATCATGCCA GTCTGGTATG CCATTTTACA GTTGTGTAAA TCCTTCTAAT
AGATTATGTC TTATATCCTG TTTATTGAAT TTCATTTGTG TTACCCATGA TTTGTCAAAG GTAGAGTTGA TTGGCTATGC
AGCAAGCAAG GATGAACTAT ACCTTATTTA CGAGTACTCT CAAAAAGGTT CACTCAAGAA TCACCTTCAT GATCCTCAAA
GCAAAGGTAT ACCATCATTT AGGACTTGTA CGAGTGATTT ACTAATTGCT TTCTGTTTAA CTTGGGTAAT CTCGCCATGT
AATGTTTCCA CTTCCAGCAG TTTTGATATT GTATTTGTTG AGTAGGTACC AATCAAAAGC AACCCTTATG TACAAGTTCT
AAAATATTGC TGCTTGAGAA CATTTCTTGA TTGCTGCTAA CTCAAGTTTT GTTAACTTTT CTTTTCTGAA CACACATACA
TTTTCTATCG TTATTGATTG ATTTTGTGTT GTTTCTTTTT CAGGTTACAC ATCATTGTCT TGGATCTACA GGGTCCAAAT
TGCTCTTGAT GCGGCTAGAG GACTTGAATA CATTCATGAG CATACAAAGG ATCATTATGT TCACAGGGAC ATCAAATCGA
GTAACATCTT GCTCGATGAA TCCTTCAGAG CAAAGGTTAA TTGATTTGAA ATTTGTTTAC TGATTTGTTT TCTCCTGGCA
CCATTTAGAA CAGCTTGTTT ACCTGCATTT TCTGTCTCCG TAGATTTCAG ATTTTGGTCT TGCAAAACTG GTAGTGAAGT
CAACTGATGC AGAGGCTTCT GTCACAAAAG TTGTGGGTAC ATTTGGTTAC TTGGCCCCTG AGTGAGTACA TTTTCTGGTA
GCTCAGTATG GATTTGGAAA AGAAAAATAT CTAGCTCAAT CCTGACATTT CATTTATTCC TGTAGATACT TGCGCGATGG
CCTGGCAACT ACGAAAAATG ATGTTTATGC TTTTGGAGTA GTACTTTTTG AGTTAATATC TGGAAAGGAG GCAATTACAA
GGACTGATGG ATTGAACGAA GGATCAAACT CAGAAAGGCG TTCCTTGGCA TCAGTTGTAA GTTTTCTAGG TTCAGCATAA
GCAATTGAAC ATATATGCCC ATTATAACTT ACGGGCTTAG AATTATTTTG CCATCCCAAG TTGCAGTGTT TTTCACTGGC
TTTATTGAAG TTTTAGTATA TTTTACTTGC TATTTTGACT CCAAAAGTTT TGAACTAATT TAGTTTTAAC AATGCAGATG
TTGAGTGCAC TAAAGAATTG TCGTAACTCA ATGTATATGG GGAGCCTGAA AGACTGCATT GACCCTAATC TAATGGACCT
GTATCCACAT GACTGTGTAT ACAAGGTATG CACAATAAAA TCTGTTGGTG CTTGATGATC AACATCTCCT GCACATTTCA
CATACCTTTG CTTCAAAGCT AAATCTCACT CTAAATTCTT CTTATAAAGA TGGCCATGCT AGCGAAACAG TGCGTGGAGG
AAGATCCTGT TCTTCGGCCA GACATGAAGC AGGCAGTAAT CACGCTATCG CAAATACTGC TGTCGTCGAT CGAGTGGGAA
GCGACGCTAG CTGGGAACAG CCAAGTGTTC AGTGGTCTTG TGGCTGGGAG GTGATCCTGT AAGATTGGCC TGGTTGCTAC
GGTGCTATCC CATGCGCTCT TCGGTGATCT CCTTCCCTGC TCCACTAGAG GCGTTTTCCC CTGTAACCTT CTCCTGCATT
TTGCTGGTTT CTTGCCCAGT TGAGCAGTTT TCTGCATCTT CTTTTCAAAG TATCTACCAC AGTGCAATAT ATTTCTTGGT
GGGTGATATG TAACCATGTA TGTATACCAA ATGTGCCTTG CAAGTTCTAA TGCAATGATC TTGCACC

Locus: Os01g0741200

Loading...

Locus: Os01g0741200

Loading...