Os01t0741900-01

Locus

Os01g0741900

Description

Auxin-responsive protein, Drought tolerance, Control of tiller outgrowth

RAP-DB Gene Symbol Synonym(s)

IAA6, OsIAA6

RAP-DB Gene Name Synonym(s)

Aux/IAA protein 6

CGSNL Gene Symbol

IAA6

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA6

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 6

Transcript Evidence

AK068600

Protein Evidence

Q8LQ74

Literature

PMID: 26025543

Note

Manual Curation

June 4, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: protein binding (GO:0005515)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

PB1 domain (IPR000270)

Full-length cDNA

J013154A18 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0741900-01)

RiceXPro (AK068600)

Others

Oryzabase (10897)

KEGG (Os01t0741900-01)

Transcript

2211 bp

>Os01t0741900-01 Auxin-responsive protein, Drought tolerance, Control of tiller outgrowth
GCTAATCTTCCAGCCACACACCTAGTCAGTCATCAAAGTGTGCGTGCTTCTCCAGAACAG
TGAGAGAGAGAGGGGCAAAGGGAGGCAGGATAAAAAGCCGAGCTGTAGGGGACTAAAGAA
GAAAGAAAAGCATAGAAAAGAACGGCAAGCAAGCAGCTCGAGGCACCCGCGCTAGTACAT
AAAGCCACCGAGGTGCGATTTCGCGAGCTCTAGCCGCTTCCACTTGGCCATTTCCCATCT
GCCTCCTGGAGCTTTAGCTCTAACTCTAGTTCTAGCTCTAGCTCCGGCTACGTTTGCAAC
TGTTGTTTATCTCCTGGTGAGTCCTCCTGTCATGTTAGCCGTAGATTTTGGCCGGAGCAC
AAGGTGTTTTTGTTGCTTGCTGATTTTACAGGTTGCAGGTTGTTCTTCTCTTTCCTGAAA
TGGTTTTGACAAAAGAGCTGTTTTGATCTGGGGCTGCCTCAATCATTTGCTTCTATGGCA
GGCTATACACCACACTTTTAAGATGTTTTAGCCTCATTGGTATTGTTTATGTTTCATTAT
GAGTTATTACGAAAGACTTTAATTAAAACAAACGTCTAGGGTGCTGCTTGTTGCACAAAT
GAGTTATTCGTTCCGCTTTCAATTTTTCATTGCCAGAACCTGATCTTAACTCCGTGTTTT
TCCGCGTTCTCTTTCGTTCTCGCTTAGACCTCAGCTTACGCTTCGGGCTGGTTTGGTGCT
TTTCTCCAGCCTAAGTTGAGTGTAGAACTAAACTTTTTAAGGAGTTGGTTGAACTCCTCT
CATTGCCTTCAAACTCTTCCTACTATTCTAGGTGGATAGCATTTAGACTCTTGAAGACTT
TGAGCTAGTTAACCTTATGGAAGAAGGGTCCAACAAAAGAGAAGGACTTCCTCCTCAACT
CCTAGATCTCATCCCAGATGAGAAGGAATGGAAGCTGAGAGAAGCATTAGGTCTAGGGAG
ATCAAGAAACGCAGGCTTCGACGGTGAAGAAGACAAGAAGCTAGACCTAAAGCTTGGTCT
TCCTGGTTTTATAGAAGATGATGAGGCAGAAACCTTAAGAGATTACAGGCTACAGCAAGA
GAGCCCATCTCTCTCCCTTAGTTTCTTTCCAAAGCACTCCAAGACCACCAGCAGCACTAC
TACGACAACTGGAGCAAAGAGGGGATTCATAGACACAGTTGAGGACAAAACAGAAGGTTA
TAACGACCAGAAGCAGCAGGCAAGGGCAGGATGTGGGAAGGAACTTGCAGTGGAGGAAAT
GATAGCAGCCGTGAGTGAGAGGAAGAAAGGATGCTGCCCCCCACCACCACCACCACATGG
TGCTCCTGCTACACCTGCGCGCAACAGACCACAGACCCAGGGAAGAGGAGCTGCAGCACC
AGTGGTTGGTTGGCCTCCAATTCGATCCTTCAGGAGAAACCTTGCTAGTAGTAGTTCATC
CAAACATTCCCCTGAACCACAAAATGATAATGCCAATGCAAAGGTGACGCTCACCTGCAA
GAAAAACCCTCTTGTAAAAATCAACATGGATGGGATCCCTATTGGAAGGAAAATAGACCT
TGCAGCCTATAACAGCTATGATGGGCTATCGTCAGCTGTCAAACAACTCTTCCATGGGTT
TCTTCAAGCTCAAAAGGACCAAACTAATGCGCAAATTGCACAGCAAGGTGCAGATGACAA
AATATTTTATCAATTGTTGGATGGGTCTGGTGAATATACTCTAGTTTATGAAGACAGTGA
AGGAGACAGGATGCTGGTTGGGGACGTGCCATGGAAAGTATTTGTCTCAACTGCTAAAAG
GCTGAGGGTTCTAAGGAGTTCAGAGCTTTCCCATACCCTGATTGGAGCTACTGCTAGGGT
CTAGCCGTCTAGGAGAGTCACCAATTGCTGAAATGCTGGGATCTTATTAACCATTCGGAA
TGAATGTGTGCACTCAAGCCAGTCCATTCTCCATTTTAGGACTACCCCTATTTTGCCTAT
ATAGATGATCTACTGAGATGAGTTGGCATACAGCAAATGCAAGGAAATGGCAATCTGTTT
TGTAAATTAGGTTACCTTGCTATGACATGTTGCTTAATTCAATTCGAAGCGATTTTGGTT
TTATCGGGGAGAGCCGCATATGTAGACTTGCAGGTCACCCATGTAAAGTGCCTTGTTCTG
CGTGATAAATTTGTATTAATCGCTGCTGCAACCCGACATGCAGATCTAATG

CDS

1008 bp

>Os01t0741900-01 Auxin-responsive protein, Drought tolerance, Control of tiller outgrowth
ATGGAAGAAGGGTCCAACAAAAGAGAAGGACTTCCTCCTCAACTCCTAGATCTCATCCCA
GATGAGAAGGAATGGAAGCTGAGAGAAGCATTAGGTCTAGGGAGATCAAGAAACGCAGGC
TTCGACGGTGAAGAAGACAAGAAGCTAGACCTAAAGCTTGGTCTTCCTGGTTTTATAGAA
GATGATGAGGCAGAAACCTTAAGAGATTACAGGCTACAGCAAGAGAGCCCATCTCTCTCC
CTTAGTTTCTTTCCAAAGCACTCCAAGACCACCAGCAGCACTACTACGACAACTGGAGCA
AAGAGGGGATTCATAGACACAGTTGAGGACAAAACAGAAGGTTATAACGACCAGAAGCAG
CAGGCAAGGGCAGGATGTGGGAAGGAACTTGCAGTGGAGGAAATGATAGCAGCCGTGAGT
GAGAGGAAGAAAGGATGCTGCCCCCCACCACCACCACCACATGGTGCTCCTGCTACACCT
GCGCGCAACAGACCACAGACCCAGGGAAGAGGAGCTGCAGCACCAGTGGTTGGTTGGCCT
CCAATTCGATCCTTCAGGAGAAACCTTGCTAGTAGTAGTTCATCCAAACATTCCCCTGAA
CCACAAAATGATAATGCCAATGCAAAGGTGACGCTCACCTGCAAGAAAAACCCTCTTGTA
AAAATCAACATGGATGGGATCCCTATTGGAAGGAAAATAGACCTTGCAGCCTATAACAGC
TATGATGGGCTATCGTCAGCTGTCAAACAACTCTTCCATGGGTTTCTTCAAGCTCAAAAG
GACCAAACTAATGCGCAAATTGCACAGCAAGGTGCAGATGACAAAATATTTTATCAATTG
TTGGATGGGTCTGGTGAATATACTCTAGTTTATGAAGACAGTGAAGGAGACAGGATGCTG
GTTGGGGACGTGCCATGGAAAGTATTTGTCTCAACTGCTAAAAGGCTGAGGGTTCTAAGG
AGTTCAGAGCTTTCCCATACCCTGATTGGAGCTACTGCTAGGGTCTAG

Protein

336 aa

>Os01t0741900-01 Auxin-responsive protein, Drought tolerance, Control of tiller outgrowth
MEEGSNKREGLPPQLLDLIPDEKEWKLREALGLGRSRNAGFDGEEDKKLDLKLGLPGFIE
DDEAETLRDYRLQQESPSLSLSFFPKHSKTTSSTTTTTGAKRGFIDTVEDKTEGYNDQKQ
QARAGCGKELAVEEMIAAVSERKKGCCPPPPPPHGAPATPARNRPQTQGRGAAAPVVGWP
PIRSFRRNLASSSSSKHSPEPQNDNANAKVTLTCKKNPLVKINMDGIPIGRKIDLAAYNS
YDGLSSAVKQLFHGFLQAQKDQTNAQIAQQGADDKIFYQLLDGSGEYTLVYEDSEGDRML
VGDVPWKVFVSTAKRLRVLRSSELSHTLIGATARV*

5'UTR

chr01:30975765..30976620 (+ strand) : 856 bp

CDS

chr01:30976621..30976960 (+ strand) : 340 bp

chr01:30977088..30977256 (+ strand) : 169 bp

chr01:30978115..30978377 (+ strand) : 263 bp

chr01:30978459..30978606 (+ strand) : 148 bp

chr01:30978761..30978824 (+ strand) : 64 bp

chr01:30978967..30978990 (+ strand) : 24 bp

3'UTR

chr01:30978991..30979337 (+ strand) : 347 bp

FASTA

>Os01t0741900-01 class=Sequence position=chr01:30975765..30979337 (+ strand)
GCTAATCTTC CAGCCACACA CCTAGTCAGT CATCAAAGTG TGCGTGCTTC TCCAGAACAG TGAGAGAGAG AGGGGCAAAG
GGAGGCAGGA TAAAAAGCCG AGCTGTAGGG GACTAAAGAA GAAAGAAAAG CATAGAAAAG AACGGCAAGC AAGCAGCTCG
AGGCACCCGC GCTAGTACAT AAAGCCACCG AGGTGCGATT TCGCGAGCTC TAGCCGCTTC CACTTGGCCA TTTCCCATCT
GCCTCCTGGA GCTTTAGCTC TAACTCTAGT TCTAGCTCTA GCTCCGGCTA CGTTTGCAAC TGTTGTTTAT CTCCTGGTGA
GTCCTCCTGT CATGTTAGCC GTAGATTTTG GCCGGAGCAC AAGGTGTTTT TGTTGCTTGC TGATTTTACA GGTTGCAGGT
TGTTCTTCTC TTTCCTGAAA TGGTTTTGAC AAAAGAGCTG TTTTGATCTG GGGCTGCCTC AATCATTTGC TTCTATGGCA
GGCTATACAC CACACTTTTA AGATGTTTTA GCCTCATTGG TATTGTTTAT GTTTCATTAT GAGTTATTAC GAAAGACTTT
AATTAAAACA AACGTCTAGG GTGCTGCTTG TTGCACAAAT GAGTTATTCG TTCCGCTTTC AATTTTTCAT TGCCAGAACC
TGATCTTAAC TCCGTGTTTT TCCGCGTTCT CTTTCGTTCT CGCTTAGACC TCAGCTTACG CTTCGGGCTG GTTTGGTGCT
TTTCTCCAGC CTAAGTTGAG TGTAGAACTA AACTTTTTAA GGAGTTGGTT GAACTCCTCT CATTGCCTTC AAACTCTTCC
TACTATTCTA GGTGGATAGC ATTTAGACTC TTGAAGACTT TGAGCTAGTT AACCTTATGG AAGAAGGGTC CAACAAAAGA
GAAGGACTTC CTCCTCAACT CCTAGATCTC ATCCCAGATG AGAAGGAATG GAAGCTGAGA GAAGCATTAG GTCTAGGGAG
ATCAAGAAAC GCAGGCTTCG ACGGTGAAGA AGACAAGAAG CTAGACCTAA AGCTTGGTCT TCCTGGTTTT ATAGAAGATG
ATGAGGCAGA AACCTTAAGA GATTACAGGC TACAGCAAGA GAGCCCATCT CTCTCCCTTA GTTTCTTTCC AAAGCACTCC
AAGACCACCA GCAGCACTAC TACGACAACT GGAGCAAAGA GGGGATTCAT AGACACAGTT GAGGACAAAA CAGAAGGTAA
CAAACAGCTT TTCAGTTCTC TCGTGAGCTT GTTCTTGAAA CATGTTTATA CTTGGGATTA GAAACATGGA AACAAACTGA
TGGAAGCACT GAACTGAAAA TTACTCTTTT GTTGCTTTAT AAGGTTATAA CGACCAGAAG CAGCAGGCAA GGGCAGGATG
TGGGAAGGAA CTTGCAGTGG AGGAAATGAT AGCAGCCGTG AGTGAGAGGA AGAAAGGATG CTGCCCCCCA CCACCACCAC
CACATGGTGC TCCTGCTACA CCTGCGCGCA ACAGACCACA GACCCAGGGA AGGTACTGAT AGCCTATATG GTGCTTTTTC
CATCTTTTCT GCTCTCAGCC AAGGAACACA TGCTCGTTTA TTCCTGTCAC TCATTTATAG TTCATTCGAA GGATTGCATA
TAGTCCCTCC ATGCTCTTTT CCAGGTTCCC AGAAATCGCA GGTGTCCTAT GTCCATTTCA ATCTTTTGAT TTTAACGTGA
CGTGCAATGG CTAATTTACT TAGCTGTTCT TGGTCGATAT GAACCTCAAA GAATATACTA CTTCTTTTAT CCCTCAAAAA
GCACCCCTTT TTTTATAGAA AGAGAGTTGT CCTTTTTCTA AACACTAAAC TTAATTCCTA CGCTCATAGT CTTGTCTATT
TATCACTTAT TCAACTAAgg gcattcccga cccaatgact aggatggtgt ccatagcatt aaataagctg ccacctagga
taaaaaatga tgtggcaaat gaattaatga ggaaagagaa ggaaaccatg tcttgcatga gacatgattt ctacataaca
tccaagatat tatgtgagat aagtagcatt aaatttaagt atggaatagt agtgtttgca ttggaagagt agtgtctagt
actagtttct tgatgatgta gagtttatgg aaactatatc tagtgtcttg ggttgagaat gcccTAAGTC TCCTTGGGCA
CATATATTCT TGGATTATAA TCACTCTAAC AGTTTAATTG GTTGGAACAA TAGCAGTACA AATAGAAAAA TATATATACT
AGTACAACCA ATTAAATTAT TTTAACTATT TTATTTTATT AATATTATGC AATCATTTAT CTCGATGGCC TTTCAGAGAC
GAACTCACCA GTTTTCTAAC CTGTTTGTAG AGGAGCTGCA GCACCAGTGG TTGGTTGGCC TCCAATTCGA TCCTTCAGGA
GAAACCTTGC TAGTAGTAGT TCATCCAAAC ATTCCCCTGA ACCACAAAAT GATAATGCCA ATGCAAAGGT GACGCTCACC
TGCAAGAAAA ACCCTCTTGT AAAAATCAAC ATGGATGGGA TCCCTATTGG AAGGAAAATA GACCTTGCAG CCTATAACAG
CTATGATGGG CTATCGTCAG CTGTCAAACA ACTCTTCCAT GGGTTTCTTC AAGGTAGAAA TTAACAATCT ATCCAAATAA
AATAAGTACT TCATTTTTTA TAAAATTCTT AGCTTTTATC TGATCATATT GCAGCTCAAA AGGACCAAAC TAATGCGCAA
ATTGCACAGC AAGGTGCAGA TGACAAAATA TTTTATCAAT TGTTGGATGG GTCTGGTGAA TATACTCTAG TTTATGAAGA
CAGTGAAGGA GACAGGATGC TGGTTGGGGA CGTGCCATGG AAGTAAGTTT GCTGGTCCCC CTTGTCATTT ACAGTTTTTA
CTGGCATTTA CAAAATAATC AAATCTTAAA AACAACAAAA GGACACTGCC ACCATAATTT ATATTAGGCA CCACCAAACC
ATCTAAATTA TTTTTCCTGT TCTCCAATTC CTGCAGAGTA TTTGTCTCAA CTGCTAAAAG GCTGAGGGTT CTAAGGAGTT
CAGAGCTTTC CCATACCCTG GTAAGACAAG CTAGACCACT TAAAGTCGTG TCCAAATCTT TGGTGTAGCC ATAAAAAAAT
TAGCTTTCGC TAAATTTGAA TGAAGATAGC TACACTTTTA TGTTAGTCTC ATATTCTTTA CTATTTTTTT CCTATTCTCC
AGATTGGAGC TACTGCTAGG GTCTAGCCGT CTAGGAGAGT CACCAATTGC TGAAATGCTG GGATCTTATT AACCATTCGG
AATGAATGTG TGCACTCAAG CCAGTCCATT CTCCATTTTA GGACTACCCC TATTTTGCCT ATATAGATGA TCTACTGAGA
TGAGTTGGCA TACAGCAAAT GCAAGGAAAT GGCAATCTGT TTTGTAAATT AGGTTACCTT GCTATGACAT GTTGCTTAAT
TCAATTCGAA GCGATTTTGG TTTTATCGGG GAGAGCCGCA TATGTAGACT TGCAGGTCAC CCATGTAAAG TGCCTTGTTC
TGCGTGATAA ATTTGTATTA ATCGCTGCTG CAACCCGACA TGCAGATCTA ATG

Locus: Os01g0741900

Loading...

Locus: Os01g0741900

Loading...