Os01t0749300-01

Locus

Os01g0749300

Description

Heat shock transcription factor, Cadmium tolerance, Heat stress response

RAP-DB Gene Symbol Synonym(s)

HSFA4A, OsHsfA4a, OsHsf-04, HSFA4B, HSF04, HSF9, OsHsfA4b, OsHSF9

RAP-DB Gene Name Synonym(s)

HEAT STRESS TRANSCRIPTION FACTOR A4a, Heat stress transcription factor A4a, Heat stress transcription factor A-4b, Heat stress transcription factor 4, heat shock transcription factor 9

CGSNL Gene Symbol

HSFA4A

CGSNL Gene Name

HEAT STRESS TRANSCRIPTION FACTOR A4a

Oryzabase Gene Symbol Synonym(s)

OsHsfA4a, OsHsf-04, HSFA4B, HSF04, OsHSF4, HSF4, HSF9, OsHsfA4b, OsHSF9

Oryzabase Gene Name Synonym(s)

Heat stress transcription factor A4a, Heat stress transcription factor A-4b, Heat stress transcription factor 4, heat shock transcription factor 9

Transcript Evidence

AY344491 (DDBJ)

Protein Evidence

Q94J16 (UniProt)

Literature

PMID: 15200645

PMID: 17150959

PMID: 20028842

PMID: 18407058

PMID: 19192388

Note

Manual Curation

January 25, 2010

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Heat shock factor (HSF)-type, DNA-binding (IPR000232)

Expression Databases

TENOR (Os01t0749300-01)

Others

Oryzabase (8554)

Transcript

1548 bp

>Os01t0749300-01 Heat shock transcription factor, Cadmium tolerance, Heat stress response
CCTGACGGCAACCCTAGCCCTCCGATCACCGGCGCTGAGACTGATCCCGCCGCCGTAGGA
GGAGGAGGAGGAGGTGGTGGTGGTGGTGGTGATGGAGGGGGGCGGCGGGGGCGGGTCGCT
GCCGCCGTTCCTGAGCAAGACGTACGAGATGGTGGACGACCCGTCGACGGACGCGGTGGT
GGGGTGGACGCCCGCCGGCACCAGCTTCGTCGTCGCCAACCAGCCCGAGTTCTGCCGGGA
TCTGCTCCCCAAGTACTTCAAGCACAACAACTTCTCCAGCTTCGTGCGACAGCTCAACAC
CTATGGCTTTAGGAAAGTAGATCCAGAACAATGGGAATTTGCAAATGAGGATTTCATAAA
AGGACAGCGGCACCGGTTGAAAAATATACATAGACGCAAACCTATATTCAGCCATTCATC
ACACAGTCAGGGTGCTGGACCATTAACAGATAATGAAAGGAAAGACTATGAGGAAGAAAT
CGAGAGGCTCAAATCCGATAATGCAGCACTGTCCTCAGAGCTTCAAAATAATACGTTGAA
GAAACTTAATATGGAGAAACGAATGCAGGCTTTGGAAGAGAAGCTATTTGTTGTGGAAGA
TCAGCAGAGGAGTCTGATATCATACGTCAGAGAGATTGTAAAGGCACCAGGATTTCTTTC
TAGCTTTGTACAGCAACAAGATCATCACAGGAAGAAGAGGAGACTGCCAATACCAATCTC
CTTCCATGAGGATGCAAATACTCAGGAGAACCAGATCATGCCTTGTGACTTGACCAACTC
ACCAGCTCAGACATTTTACAGAGAATCATTTGACAAGATGGAATCATCCTTGAACTCATT
AGAAAATTTCCTTCGAGAAGCAAGTGAAGAATTTGGTAATGATATTTCATATGATGATGG
TGTCCCAGGCCCTTCTTCAACTGTTGTTCTCACAGAGCTCCATTCACCTGGTGAAAGTGA
TCCCCGTGTTTCATCACCTCCAACAAGGATGCGTACTTCGTCAGCTGGTGCAGGAGATTC
GCACTCCTCTCGTGATGTAGCAGAGTCTACCAGCTGTGCAGAAAGTCCTCCTATTCCTCA
AATGCATTCTCGTGTAGATACACGAGCGAAGGTTTCTGAAATAGATGTTAATTCAGAACC
TGCTGTTACAGAAACTGGTCCATCAAGAGATCAACCTGCTGAAGAGCCTCCTGCTGTCAC
ACCTGGTGCAAACGATGGCTTCTGGCAGCAGTTTCTTACCGAGCAGCCTGGATCATCAGA
TGCACATCAGGAGGCTCAATCAGAACGGCGAGATGGAGGAAACAAGGTGGATGAGATGAA
ATCAGGAGATCGACAACATCTTTGGTGGGGCAAAAGGAACGTTGAGCAGATAACAGAAAA
ACTTGGACTTCTCACCTCAACGGAGAAAACCTGACATAATTTTGTTTTTCTTTTTGTAGA
TGAAAAACTATTAATTCAGGAACGCTGACATTGGTGCCTTCCTCAGTGAGATATGTTGAC
TAACATCTATTTCGCAGTGTACCGTATTTTTTCCATCATGTACCGTAA

CDS

1323 bp

>Os01t0749300-01 Heat shock transcription factor, Cadmium tolerance, Heat stress response
ATGGAGGGGGGCGGCGGGGGCGGGTCGCTGCCGCCGTTCCTGAGCAAGACGTACGAGATG
GTGGACGACCCGTCGACGGACGCGGTGGTGGGGTGGACGCCCGCCGGCACCAGCTTCGTC
GTCGCCAACCAGCCCGAGTTCTGCCGGGATCTGCTCCCCAAGTACTTCAAGCACAACAAC
TTCTCCAGCTTCGTGCGACAGCTCAACACCTATGGCTTTAGGAAAGTAGATCCAGAACAA
TGGGAATTTGCAAATGAGGATTTCATAAAAGGACAGCGGCACCGGTTGAAAAATATACAT
AGACGCAAACCTATATTCAGCCATTCATCACACAGTCAGGGTGCTGGACCATTAACAGAT
AATGAAAGGAAAGACTATGAGGAAGAAATCGAGAGGCTCAAATCCGATAATGCAGCACTG
TCCTCAGAGCTTCAAAATAATACGTTGAAGAAACTTAATATGGAGAAACGAATGCAGGCT
TTGGAAGAGAAGCTATTTGTTGTGGAAGATCAGCAGAGGAGTCTGATATCATACGTCAGA
GAGATTGTAAAGGCACCAGGATTTCTTTCTAGCTTTGTACAGCAACAAGATCATCACAGG
AAGAAGAGGAGACTGCCAATACCAATCTCCTTCCATGAGGATGCAAATACTCAGGAGAAC
CAGATCATGCCTTGTGACTTGACCAACTCACCAGCTCAGACATTTTACAGAGAATCATTT
GACAAGATGGAATCATCCTTGAACTCATTAGAAAATTTCCTTCGAGAAGCAAGTGAAGAA
TTTGGTAATGATATTTCATATGATGATGGTGTCCCAGGCCCTTCTTCAACTGTTGTTCTC
ACAGAGCTCCATTCACCTGGTGAAAGTGATCCCCGTGTTTCATCACCTCCAACAAGGATG
CGTACTTCGTCAGCTGGTGCAGGAGATTCGCACTCCTCTCGTGATGTAGCAGAGTCTACC
AGCTGTGCAGAAAGTCCTCCTATTCCTCAAATGCATTCTCGTGTAGATACACGAGCGAAG
GTTTCTGAAATAGATGTTAATTCAGAACCTGCTGTTACAGAAACTGGTCCATCAAGAGAT
CAACCTGCTGAAGAGCCTCCTGCTGTCACACCTGGTGCAAACGATGGCTTCTGGCAGCAG
TTTCTTACCGAGCAGCCTGGATCATCAGATGCACATCAGGAGGCTCAATCAGAACGGCGA
GATGGAGGAAACAAGGTGGATGAGATGAAATCAGGAGATCGACAACATCTTTGGTGGGGC
AAAAGGAACGTTGAGCAGATAACAGAAAAACTTGGACTTCTCACCTCAACGGAGAAAACC
TGA

Protein

440 aa

>Os01t0749300-01 Heat shock transcription factor, Cadmium tolerance, Heat stress response
MEGGGGGGSLPPFLSKTYEMVDDPSTDAVVGWTPAGTSFVVANQPEFCRDLLPKYFKHNN
FSSFVRQLNTYGFRKVDPEQWEFANEDFIKGQRHRLKNIHRRKPIFSHSSHSQGAGPLTD
NERKDYEEEIERLKSDNAALSSELQNNTLKKLNMEKRMQALEEKLFVVEDQQRSLISYVR
EIVKAPGFLSSFVQQQDHHRKKRRLPIPISFHEDANTQENQIMPCDLTNSPAQTFYRESF
DKMESSLNSLENFLREASEEFGNDISYDDGVPGPSSTVVLTELHSPGESDPRVSSPPTRM
RTSSAGAGDSHSSRDVAESTSCAESPPIPQMHSRVDTRAKVSEIDVNSEPAVTETGPSRD
QPAEEPPAVTPGANDGFWQQFLTEQPGSSDAHQEAQSERRDGGNKVDEMKSGDRQHLWWG
KRNVEQITEKLGLLTSTEKT*

5'UTR

chr01:31370502..31370592 (+ strand) : 91 bp

CDS

chr01:31370593..31370805 (+ strand) : 213 bp

chr01:31371388..31372497 (+ strand) : 1110 bp

3'UTR

chr01:31372498..31372631 (+ strand) : 134 bp

FASTA

>Os01t0749300-01 class=Sequence position=chr01:31370502..31372631 (+ strand)
CCTGACGGCA ACCCTAGCCC TCCGATCACC GGCGCTGAGA CTGATCCCGC CGCCGTAGGA GGAGGAGGAG GAGGTGGTGG
TGGTGGTGGT GATGGAGGGG GGCGGCGGGG GCGGGTCGCT GCCGCCGTTC CTGAGCAAGA CGTACGAGAT GGTGGACGAC
CCGTCGACGG ACGCGGTGGT GGGGTGGACG CCCGCCGGCA CCAGCTTCGT CGTCGCCAAC CAGCCCGAGT TCTGCCGGGA
TCTGCTCCCC AAGTACTTCA AGCACAACAA CTTCTCCAGC TTCGTGCGAC AGCTCAACAC CTATGTAAGG GAGCTCGCCT
CTTAACCTCA TGTGTGCCTT TCTGTCTTCC TCTGCTCTGC CGCTGATGCT TGAATTGGGG CTTGGTCGTA ATGCGCGCCC
GCCGGGACCT ATGGGCTGGG TAGGAATGCC GGATTTGTTA GAATTGGGCG AGTCCTTTGC TGTAATTACT CCTGTTTAGG
ATTTATTACT TTCAGCACAA AATATTTTAT AAGTTTTCGT TGATTGCTAG TATAGCATAT TCTGTTCATT TTAGGATTTT
AAGACAGTAC TTGTGAATAA CCAAGGTCAA CTCTTGTTCT ACCAAGAAAA TTCAAGTAGC TTATTGCAAT GTTATTGTCT
TCTCCATCCG GTTGAAGTTG TACAAAAATG TTTGATAATG GTGAGTGAGG TTGAAATAGA TGTGTGTTCA CATCAATGTC
AAAGCTCCAA ACTGTTTTAG AATTGAAGCA AGCTATCCGG TACAGTTCAT TCCTTGTGGT GGCAGTGCAT AGTTTTTTTT
AGCCTTGATC ATGTATGATT TTTTTTCCCC TTTTGGCTGC TTGAGTTATG CTATTTTAAT GAGGATCCCC TTTTGTTCTC
ATTTAGGGCT TTAGGAAAGT AGATCCAGAA CAATGGGAAT TTGCAAATGA GGATTTCATA AAAGGACAGC GGCACCGGTT
GAAAAATATA CATAGACGCA AACCTATATT CAGCCATTCA TCACACAGTC AGGGTGCTGG ACCATTAACA GATAATGAAA
GGAAAGACTA TGAGGAAGAA ATCGAGAGGC TCAAATCCGA TAATGCAGCA CTGTCCTCAG AGCTTCAAAA TAATACGTTG
AAGAAACTTA ATATGGAGAA ACGAATGCAG GCTTTGGAAG AGAAGCTATT TGTTGTGGAA GATCAGCAGA GGAGTCTGAT
ATCATACGTC AGAGAGATTG TAAAGGCACC AGGATTTCTT TCTAGCTTTG TACAGCAACA AGATCATCAC AGGAAGAAGA
GGAGACTGCC AATACCAATC TCCTTCCATG AGGATGCAAA TACTCAGGAG AACCAGATCA TGCCTTGTGA CTTGACCAAC
TCACCAGCTC AGACATTTTA CAGAGAATCA TTTGACAAGA TGGAATCATC CTTGAACTCA TTAGAAAATT TCCTTCGAGA
AGCAAGTGAA GAATTTGGTA ATGATATTTC ATATGATGAT GGTGTCCCAG GCCCTTCTTC AACTGTTGTT CTCACAGAGC
TCCATTCACC TGGTGAAAGT GATCCCCGTG TTTCATCACC TCCAACAAGG ATGCGTACTT CGTCAGCTGG TGCAGGAGAT
TCGCACTCCT CTCGTGATGT AGCAGAGTCT ACCAGCTGTG CAGAAAGTCC TCCTATTCCT CAAATGCATT CTCGTGTAGA
TACACGAGCG AAGGTTTCTG AAATAGATGT TAATTCAGAA CCTGCTGTTA CAGAAACTGG TCCATCAAGA GATCAACCTG
CTGAAGAGCC TCCTGCTGTC ACACCTGGTG CAAACGATGG CTTCTGGCAG CAGTTTCTTA CCGAGCAGCC TGGATCATCA
GATGCACATC AGGAGGCTCA ATCAGAACGG CGAGATGGAG GAAACAAGGT GGATGAGATG AAATCAGGAG ATCGACAACA
TCTTTGGTGG GGCAAAAGGA ACGTTGAGCA GATAACAGAA AAACTTGGAC TTCTCACCTC AACGGAGAAA ACCTGACATA
ATTTTGTTTT TCTTTTTGTA GATGAAAAAC TATTAATTCA GGAACGCTGA CATTGGTGCC TTCCTCAGTG AGATATGTTG
ACTAACATCT ATTTCGCAGT GTACCGTATT TTTTCCATCA TGTACCGTAA 

Locus: Os01g0749300

Loading...

Locus: Os01g0749300

Loading...