Os01t0749300-02

Locus

Os01g0749300

Description

Heat shock transcription factor, Cadmium tolerance, Heat stress response

RAP-DB Gene Symbol Synonym(s)

HSFA4A, OsHsfA4a, OsHsfA4b, OsHsf-04, HSFA4B, HSF04, OsHSF9, RHSF9, HSF9

RAP-DB Gene Name Synonym(s)

HEAT STRESS TRANSCRIPTION FACTOR A4a, Heat shock transcription factor A4a, Heat stress transcription factor A4a, Heat stress transcription factor A-4b, Heat stress transcription factor 4, Heat shock transcription factor 9

CGSNL Gene Symbol

HSFA4A

CGSNL Gene Name

HEAT STRESS TRANSCRIPTION FACTOR A4a

Oryzabase Gene Symbol Synonym(s)

OsHsfA4a, OsHsf-04, HSFA4B, HSF04, OsHSF4, HSF4, HSF9, OsHsfA4b, OsHSF9

Oryzabase Gene Name Synonym(s)

Heat stress transcription factor A4a, Heat stress transcription factor A-4b, Heat stress transcription factor 4, heat shock transcription factor 9

Transcript Evidence

AK109856 (DDBJ)

Protein Evidence

Q94J16 (UniProt)

B7F2T5 (UniProt)

Literature

PMID: 15200645

PMID: 17150959

PMID: 20028842

PMID: 18407058

PMID: 19192388

Note

Manual Curation

January 25, 2010

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Heat shock factor (HSF)-type, DNA-binding (IPR000232)

Full-length cDNA

002-148-G05 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0749300-02)

RiceXPro (AK109856)

Others

Oryzabase (8554)

Transcript

1735 bp

>Os01t0749300-02 Heat shock transcription factor, Cadmium tolerance, Heat stress response
AATCCGAGAGGGATTTTTCCTCGCAACCAACCAAACCAACCAAACCCCCAACCAAGCGAG
CAAGCCGCCTTCGCCGGGGGGGCCCCCACCCTGACGGCAACCCTAGCCCTCCGATCACCG
GCGCTGAGACTGATCCCGCCGCCGTAGGAGGAGGAGGAGGAGGTGGTGGTGGTGGTGGTG
ATGGAGGGGGGCGGCGGGGGCGGGTCGCTGCCGCCGTTCCTGAGCAAGACGTACGAGATG
GTGGACGACCCGTCGACGGACGCGGTGGTGGGGTGGACGCCCGCCGGCACCAGCTTCGTC
GTCGCCAACCAGCCCGAGTTCTGCCGGGATCTGCTCCCCAAGTACTTCAAGCACAACAAC
TTCTCCAGCTTCGTGCGACAGCTCAACACCTATGGCTTTAGGAAAGTAGATCCAGAACAA
TGGGAATTTGCAAATGAGGATTTCATAAAAGGACAGCGGCACCGGTTGAAAAATATACAT
AGACGCAAACCTATATTCAGCCATTCATCACACAGTCAGGGTGCTGGACCATTAACAGAT
AATGAAAGGAAAGACTATGAGGAAGAAATCGAGAGGCTCAAATCCGATAATGCAGCACTG
TCCTCAGAGCTTCAAAATAATACGTTGAAGAAACTTAATATGGAGAAACGAATGCAGGCT
TTGGAAGAGAAGCTATTTGTTGTGGAAGATCAGCAGAGGAGTCTGATATCATACGTCAGA
GAGATTGTAAAGGCACCAGGATTTCTTTCTAGCTTTGTACAGCAACAAGATCATCACAGG
AAGAAGAGGAGACTGCCAATACCAATCTCCTTCCATGAGGATGCAAATACTCAGGAGAAC
CAGATCATGCCTTGTGACTTGACCAACTCACCAGCTCAGACATTTTACAGAGAATCATTT
GACAAGATGGAATCATCCTTGAACTCATTAGAAAATTTCCTTCGAGAAGCAAGTGAAGAA
TTTGGTAATGATATTTCATATGATGATGGTGTCCCAGGCCCTTCTTCAACTGTTGTTCTC
ACAGAGCTCCATTCACCTGGTGAAAGTGATCCCCGTGTTTCATCACCTCCAACAAGGATG
CGTACTTCGTCAGCTGGTGCAGGAGATTCGCACTCCTCTCGTGATGTAGCAGAGTCTACC
AGCTGTGCAGAAAGTCCTCCTATTCCTCAAATGCATTCTCGTGTAGATACACGAGCGAAG
GTTTCTGAAATAGATGTTAATTCAGAACCTGCTGTTACAGAAACTGGTCCATCAAGAGAT
CAACCTGCTGAAGAGCCTCCTGCTGTCACACCTGGTGCAAACGATGGCTTCTGGCAGCAG
TTTCTTACCGAGCAGCCTGGATCATCAGATGCACATCAGGAGGCTCAATCAGAACGGCGA
GATGGAGGAAACAAGGTGGATGAGATGAAATCAGGAGATCGACAACATCTTTGGTGGGGC
AAAAGGAACGTTGAGCAGATAACAGAAAAACTTGGACTTCTCACCTCAACGGAGAAAACC
TGACATAATTTTGTTTTTCTTTTTGTAGATGAAAAACTATTAATTCAGGAACGCTGACAT
TGGTGCCTTCCTCAGTGAGATATGTTGACTAACATCTATTTCGCAGTGTACCGTATTTTT
TCCATCATGTACCGTAATGTATCATAGTGCCATACATTCATCTTTGGTCCATTGACACTT
TCTGATATCATTGTGCGTGATTTCTAAAATATTCTCAAGTTTGGTTAAATGTTAC

CDS

1323 bp

>Os01t0749300-02 Heat shock transcription factor, Cadmium tolerance, Heat stress response
ATGGAGGGGGGCGGCGGGGGCGGGTCGCTGCCGCCGTTCCTGAGCAAGACGTACGAGATG
GTGGACGACCCGTCGACGGACGCGGTGGTGGGGTGGACGCCCGCCGGCACCAGCTTCGTC
GTCGCCAACCAGCCCGAGTTCTGCCGGGATCTGCTCCCCAAGTACTTCAAGCACAACAAC
TTCTCCAGCTTCGTGCGACAGCTCAACACCTATGGCTTTAGGAAAGTAGATCCAGAACAA
TGGGAATTTGCAAATGAGGATTTCATAAAAGGACAGCGGCACCGGTTGAAAAATATACAT
AGACGCAAACCTATATTCAGCCATTCATCACACAGTCAGGGTGCTGGACCATTAACAGAT
AATGAAAGGAAAGACTATGAGGAAGAAATCGAGAGGCTCAAATCCGATAATGCAGCACTG
TCCTCAGAGCTTCAAAATAATACGTTGAAGAAACTTAATATGGAGAAACGAATGCAGGCT
TTGGAAGAGAAGCTATTTGTTGTGGAAGATCAGCAGAGGAGTCTGATATCATACGTCAGA
GAGATTGTAAAGGCACCAGGATTTCTTTCTAGCTTTGTACAGCAACAAGATCATCACAGG
AAGAAGAGGAGACTGCCAATACCAATCTCCTTCCATGAGGATGCAAATACTCAGGAGAAC
CAGATCATGCCTTGTGACTTGACCAACTCACCAGCTCAGACATTTTACAGAGAATCATTT
GACAAGATGGAATCATCCTTGAACTCATTAGAAAATTTCCTTCGAGAAGCAAGTGAAGAA
TTTGGTAATGATATTTCATATGATGATGGTGTCCCAGGCCCTTCTTCAACTGTTGTTCTC
ACAGAGCTCCATTCACCTGGTGAAAGTGATCCCCGTGTTTCATCACCTCCAACAAGGATG
CGTACTTCGTCAGCTGGTGCAGGAGATTCGCACTCCTCTCGTGATGTAGCAGAGTCTACC
AGCTGTGCAGAAAGTCCTCCTATTCCTCAAATGCATTCTCGTGTAGATACACGAGCGAAG
GTTTCTGAAATAGATGTTAATTCAGAACCTGCTGTTACAGAAACTGGTCCATCAAGAGAT
CAACCTGCTGAAGAGCCTCCTGCTGTCACACCTGGTGCAAACGATGGCTTCTGGCAGCAG
TTTCTTACCGAGCAGCCTGGATCATCAGATGCACATCAGGAGGCTCAATCAGAACGGCGA
GATGGAGGAAACAAGGTGGATGAGATGAAATCAGGAGATCGACAACATCTTTGGTGGGGC
AAAAGGAACGTTGAGCAGATAACAGAAAAACTTGGACTTCTCACCTCAACGGAGAAAACC
TGA

Protein

440 aa

>Os01t0749300-02 Heat shock transcription factor, Cadmium tolerance, Heat stress response
MEGGGGGGSLPPFLSKTYEMVDDPSTDAVVGWTPAGTSFVVANQPEFCRDLLPKYFKHNN
FSSFVRQLNTYGFRKVDPEQWEFANEDFIKGQRHRLKNIHRRKPIFSHSSHSQGAGPLTD
NERKDYEEEIERLKSDNAALSSELQNNTLKKLNMEKRMQALEEKLFVVEDQQRSLISYVR
EIVKAPGFLSSFVQQQDHHRKKRRLPIPISFHEDANTQENQIMPCDLTNSPAQTFYRESF
DKMESSLNSLENFLREASEEFGNDISYDDGVPGPSSTVVLTELHSPGESDPRVSSPPTRM
RTSSAGAGDSHSSRDVAESTSCAESPPIPQMHSRVDTRAKVSEIDVNSEPAVTETGPSRD
QPAEEPPAVTPGANDGFWQQFLTEQPGSSDAHQEAQSERRDGGNKVDEMKSGDRQHLWWG
KRNVEQITEKLGLLTSTEKT*

5'UTR

chr01:31370413..31370592 (+ strand) : 180 bp

CDS

chr01:31370593..31370805 (+ strand) : 213 bp

chr01:31371388..31372497 (+ strand) : 1110 bp

3'UTR

chr01:31372498..31372729 (+ strand) : 232 bp

FASTA

>Os01t0749300-02 class=Sequence position=chr01:31370413..31372729 (+ strand)
AATCCGAGAG GGATTTTTCC TCGCAACCAA CCAAACCAAC CAAACCCCCA ACCAAGCGAG CAAGCCGCCT TCGCCGGGGG
GGCCCCCACC CTGACGGCAA CCCTAGCCCT CCGATCACCG GCGCTGAGAC TGATCCCGCC GCCGTAGGAG GAGGAGGAGG
AGGTGGTGGT GGTGGTGGTG ATGGAGGGGG GCGGCGGGGG CGGGTCGCTG CCGCCGTTCC TGAGCAAGAC GTACGAGATG
GTGGACGACC CGTCGACGGA CGCGGTGGTG GGGTGGACGC CCGCCGGCAC CAGCTTCGTC GTCGCCAACC AGCCCGAGTT
CTGCCGGGAT CTGCTCCCCA AGTACTTCAA GCACAACAAC TTCTCCAGCT TCGTGCGACA GCTCAACACC TATGTAAGGG
AGCTCGCCTC TTAACCTCAT GTGTGCCTTT CTGTCTTCCT CTGCTCTGCC GCTGATGCTT GAATTGGGGC TTGGTCGTAA
TGCGCGCCCG CCGGGACCTA TGGGCTGGGT AGGAATGCCG GATTTGTTAG AATTGGGCGA GTCCTTTGCT GTAATTACTC
CTGTTTAGGA TTTATTACTT TCAGCACAAA ATATTTTATA AGTTTTCGTT GATTGCTAGT ATAGCATATT CTGTTCATTT
TAGGATTTTA AGACAGTACT TGTGAATAAC CAAGGTCAAC TCTTGTTCTA CCAAGAAAAT TCAAGTAGCT TATTGCAATG
TTATTGTCTT CTCCATCCGG TTGAAGTTGT ACAAAAATGT TTGATAATGG TGAGTGAGGT TGAAATAGAT GTGTGTTCAC
ATCAATGTCA AAGCTCCAAA CTGTTTTAGA ATTGAAGCAA GCTATCCGGT ACAGTTCATT CCTTGTGGTG GCAGTGCATA
GTTTTTTTTA GCCTTGATCA TGTATGATTT TTTTTCCCCT TTTGGCTGCT TGAGTTATGC TATTTTAATG AGGATCCCCT
TTTGTTCTCA TTTAGGGCTT TAGGAAAGTA GATCCAGAAC AATGGGAATT TGCAAATGAG GATTTCATAA AAGGACAGCG
GCACCGGTTG AAAAATATAC ATAGACGCAA ACCTATATTC AGCCATTCAT CACACAGTCA GGGTGCTGGA CCATTAACAG
ATAATGAAAG GAAAGACTAT GAGGAAGAAA TCGAGAGGCT CAAATCCGAT AATGCAGCAC TGTCCTCAGA GCTTCAAAAT
AATACGTTGA AGAAACTTAA TATGGAGAAA CGAATGCAGG CTTTGGAAGA GAAGCTATTT GTTGTGGAAG ATCAGCAGAG
GAGTCTGATA TCATACGTCA GAGAGATTGT AAAGGCACCA GGATTTCTTT CTAGCTTTGT ACAGCAACAA GATCATCACA
GGAAGAAGAG GAGACTGCCA ATACCAATCT CCTTCCATGA GGATGCAAAT ACTCAGGAGA ACCAGATCAT GCCTTGTGAC
TTGACCAACT CACCAGCTCA GACATTTTAC AGAGAATCAT TTGACAAGAT GGAATCATCC TTGAACTCAT TAGAAAATTT
CCTTCGAGAA GCAAGTGAAG AATTTGGTAA TGATATTTCA TATGATGATG GTGTCCCAGG CCCTTCTTCA ACTGTTGTTC
TCACAGAGCT CCATTCACCT GGTGAAAGTG ATCCCCGTGT TTCATCACCT CCAACAAGGA TGCGTACTTC GTCAGCTGGT
GCAGGAGATT CGCACTCCTC TCGTGATGTA GCAGAGTCTA CCAGCTGTGC AGAAAGTCCT CCTATTCCTC AAATGCATTC
TCGTGTAGAT ACACGAGCGA AGGTTTCTGA AATAGATGTT AATTCAGAAC CTGCTGTTAC AGAAACTGGT CCATCAAGAG
ATCAACCTGC TGAAGAGCCT CCTGCTGTCA CACCTGGTGC AAACGATGGC TTCTGGCAGC AGTTTCTTAC CGAGCAGCCT
GGATCATCAG ATGCACATCA GGAGGCTCAA TCAGAACGGC GAGATGGAGG AAACAAGGTG GATGAGATGA AATCAGGAGA
TCGACAACAT CTTTGGTGGG GCAAAAGGAA CGTTGAGCAG ATAACAGAAA AACTTGGACT TCTCACCTCA ACGGAGAAAA
CCTGACATAA TTTTGTTTTT CTTTTTGTAG ATGAAAAACT ATTAATTCAG GAACGCTGAC ATTGGTGCCT TCCTCAGTGA
GATATGTTGA CTAACATCTA TTTCGCAGTG TACCGTATTT TTTCCATCAT GTACCGTAAT GTATCATAGT GCCATACATT
CATCTTTGGT CCATTGACAC TTTCTGATAT CATTGTGCGT GATTTCTAAA ATATTCTCAA GTTTGGTTAA ATGTTAC

Locus: Os01g0749300

Loading...

Locus: Os01g0749300

Loading...