Os01t0750300-01

Locus

Os01g0750300

Description

Cellulose synthase catalytic subunit, Secondary cell wall formation

RAP-DB Gene Symbol Synonym(s)

OsCESA4, BC7, Bc7(t)

RAP-DB Gene Name Synonym(s)

cellulose synthase catalytic subunit 4, BRITTLE CULM 7

CGSNL Gene Symbol

BC7

CGSNL Gene Name

BRITTLE CULM 7

Oryzabase Gene Symbol Synonym(s)

OsCesA4, OsCESA4, CESA4, OS_CESA04, BC11, bc7t, Bc7(t), bc-7, OsCesA 4, CesA4, FC17/CESA4, FC17, OsFC17

Oryzabase Gene Name Synonym(s)

Cellulose synthase A catalytic subunit 4 [UDP-forming], Cellulose synthase A catalytic subunit 4, brittle culm 7, brittle culm11, fragile culm 17

Transcript Evidence

AK100475

Protein Evidence

Q5JN63

Literature

PMID: 30410573

PMID: 18037139

PMID: 12970476

Note

Manual Curation

November 13, 2018

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Nucleotide-diphospho-sugar transferases (IPR029044)

Cellulose synthase (IPR005150)

Full-length cDNA

J023093O20 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0750300-01)

RiceXPro (AK100475)

Others

Oryzabase (8926)

KEGG (Os01t0750300-01 (EC:2.4.1.12))

Transcript

3461 bp

>Os01t0750300-01 Cellulose synthase catalytic subunit, Secondary cell wall formation
AGCCTCTCTCTCTCTCCCCCTCCCATTCTGCGCATTGCTCTCTGCGCGCGGTCGCGTGCT
GCTGCTCGCGGCGCCCCGGAGCGTCTCCTTTGGGGGAGAGGAGAGGAGAGGAGAGGAGAG
GGGGGTGAGCCATGATGGAGTCGGGGGTCCCGCCCTGCGCCGCGTGCGGGGACGACGCGC
ACGCCGCCTGCCGCGCCTGCAGCTACGCGCTCTGCAAGGCCTGCCTCGACGAGGACGCCG
CCGAGGGACGCACCACCTGCGCGCGCTGCGGCGGGGAGTACGGCGCGCCCGACCCAGCGC
ATGGCCAGGGGGCGGTCGTGGAGGAGGAAGTGGAAGAGAGCCACGAGCCGGCGGCCGGCG
GTGTTCGCGAGAGGGTCACCATGGCCAGCCAACTCAGCGATCACCAGGATGAAGGAGTTC
ATGCCAGGACTATGAGCACCCATGCCAGGACAATTAGCAGTGTCTCTGGAGTTGGGAGTG
AATTGAATGATGAATCTGGGAAGCCCATCTGGAAGAACAGGGTGGAGAGCTGGAAGGAGA
AAAAGAAAGAGAAGAAAGCCTCAGCAAAGAAAGCTGCAGCAAAAGCTCAAGCTCCACCTG
TTGAAGAACAGATTATGGATGAAAAAGACTTGACAGATGCATATGAGCCACTTTCTCGGA
TCATTCCTATATCGAAGAACAAGCTCACACCTTACAGGGCAGTAATCATTATGCGTCTGG
TAGTTCTGGGGCTCTTCTTTCACTACCGTATCACCAACCCTGTTTACAGCGCCTTTGGTC
TCTGGATGACATCAGTCATATGTGAGATCTGGTTTGGATTCTCCTGGATCCTGGATCAGT
TCCCCAAGTGGTGTCCTATCAATCGCGAAACTTATGTTGATAGGCTGATTGCACGATATG
GAGATGGAGAAGATTCTGGGTTGGCACCTGTAGATTTCTTtgtcagtacagtggatccat
tgaaagagcctcctctaatcactgcgaatactgttctgtccattcttgccgtggactatc
cagttgagaagatttcgtgttacgtgtcagacgatggttcggctatgctcacatttgaat
cacttgcggaaacagcagaatttgctaggagatgggttccattttgcaagaagtactcca
ttgagccacgtgcccctgagttctacttctcacagaagattgactacttgaaggacaaga
tacacccatctttcgtcaaggagcgtcgggctatgaagAGGGATTACGAAGAATACAAGG
TGAGGATAAATGCTTTGGTTGCTAAGGCTCAGAAGACACCTGAGGAAGGCTGGATTATGC
AAGATGGGACACCATGGCCTGGGAACAACCCTCGTGACCACCCTGGAATGATCCAGGTTT
TCCTTGGTGAGACCGGTGCTCGGGACTTTGACGGAAATGAGCTTCCTCGGCTAGTCTATG
TTTCGAGAGAGAAAAGACCAGGGTACCAACACCACAAGAAAGCAGGGGCCATGAACGCTT
TGGTTCGAGTatccgcagttctgacaaatgccccttacattcttaatcttgactgtgatc
actatgttaacaatagcaaagctgttcgtgaagcgatgtgtttcatgatggacccttctg
ttggtagagatgtctgctatgtccaattcccacaaaggttcgatggcattgatcgcagcg
atcgttatgccaataggaatgttgtgttctttgacGTTAACATGAAAGGGCTTGATGGCC
TCCAAGGTCCGGTTTATGTGGGAACTGGTTGTTGTTTCTATAGGCAAGCGCTCTATGGTT
ATGGACCACCATCACTGCCTGCGCTTCCAAAGTCTTCTGTCTGTTCATGGTGCTGCTGCT
GCTGTCCTAAGAAAAAAGCTGAAAAAAGTGAGAAAGAAATGCATAGAGACTCTCGACGTG
AAGACCTTGAGTCCGCCATTTTCAATCTTCGGGAAATTGACAACTATGATGAGTATGAAC
GCTCGATGCTTATCTCCCAGATGAGCTTTGAGAAGTCGTTTGGACTGTCATCAGTGTTCA
TAGAATCAACTCTTATGGAGAATGGAGGCGTTCCTGAGTCCGCAAACCCATCTACACTGA
TCAAAGAGGCCATTCATGTCATTAGCTGTGGATATGAAGAGAAAACTGAATGGGGAAAAG
AGAttggctggatctacggttcagtcacagaggatatcctgactgggtttaagatgcact
gccgtggctggcgatccatctactgcatgccgataagacccgcgttcaagggatcagcgc
caatcaacctttctgatcgtctccaccaggttctccggtgggctctcggttccgttgaga
tcttcctcagccggcactgcccactctggtacggctacggtggtggtcgtctgaaatggc
tccagagattgtcctacatcaacaccatcgtctacccgttcacctctcttcctcttattg
catactgttgcctgcccgccatttgcctgctcacaggcaaattcatcattcccacgctct
ccaacgctgcaaccatatggtttcttggcctcttcatctccatcatcgtgacgagcgtcc
tggagctgcggtggagtggcatcggcatcgaggactggtggcgcaacgagcagttctggg
tcatcggtggcgtctccgcccacctcttcgccgtgttccagggtatcctcaagatgattg
ctgggctggacaccaacttcaccgttacggccaaggcgacggacgacaccgagttcggcg
agctgtacgtgttcaagtggacgacggtgctgatcccgccgacctccatcctggtgctca
acctcgtcggcgtggtggccgggttctccgacgcgctcaacagcggctacgagtcctggg
gcccgctcttcggcaaggtgttcttcgccatgtgggtgatcatgcacttgtaccccttcc
tcaagggtctcatgggtcgccagaaccggacgcccaccatcgtcgtgctctggtctgtcc
tgctcgcctccgtcttctccctcctctgggtcaagatcgacccgttcatcGGCAGCTCCG
AGACCACCACCACCAACAGCTGCGCCAACTTCGACTGCTGAGCGACATTTGTGCTCCAGG
AGCATCCCGTTTGGCGGTGTTTTGCCGGTATTGCAAATGTGTGTATCTAATGCGACGAAG
ACGATGGGTGGTTTCCTCTCTCTGGGCTTTGTCCTCGATCTGAGAGGTGTTGTAGGTTAG
TACTCCGCATGAAAATGTTCATTGTATTGTTATTGTCTGTGATATAAGAAGTTTTGATGT
TGAAGCCGCTGAAACTATGAGAGGGCACCGTTAAATCCGTTTAATCATACTTGTAGAAAA
AAGAGGGGGAAAGAAAAGGTTTTCTTCGGTGAACTTGAAATTGGACTACTGATCAGTTTG
TAATGTTATATGACTATATGCTACTGAATCTTATCTTATGC

CDS

2970 bp

>Os01t0750300-01 Cellulose synthase catalytic subunit, Secondary cell wall formation
ATGATGGAGTCGGGGGTCCCGCCCTGCGCCGCGTGCGGGGACGACGCGCACGCCGCCTGC
CGCGCCTGCAGCTACGCGCTCTGCAAGGCCTGCCTCGACGAGGACGCCGCCGAGGGACGC
ACCACCTGCGCGCGCTGCGGCGGGGAGTACGGCGCGCCCGACCCAGCGCATGGCCAGGGG
GCGGTCGTGGAGGAGGAAGTGGAAGAGAGCCACGAGCCGGCGGCCGGCGGTGTTCGCGAG
AGGGTCACCATGGCCAGCCAACTCAGCGATCACCAGGATGAAGGAGTTCATGCCAGGACT
ATGAGCACCCATGCCAGGACAATTAGCAGTGTCTCTGGAGTTGGGAGTGAATTGAATGAT
GAATCTGGGAAGCCCATCTGGAAGAACAGGGTGGAGAGCTGGAAGGAGAAAAAGAAAGAG
AAGAAAGCCTCAGCAAAGAAAGCTGCAGCAAAAGCTCAAGCTCCACCTGTTGAAGAACAG
ATTATGGATGAAAAAGACTTGACAGATGCATATGAGCCACTTTCTCGGATCATTCCTATA
TCGAAGAACAAGCTCACACCTTACAGGGCAGTAATCATTATGCGTCTGGTAGTTCTGGGG
CTCTTCTTTCACTACCGTATCACCAACCCTGTTTACAGCGCCTTTGGTCTCTGGATGACA
TCAGTCATATGTGAGATCTGGTTTGGATTCTCCTGGATCCTGGATCAGTTCCCCAAGTGG
TGTCCTATCAATCGCGAAACTTATGTTGATAGGCTGATTGCACGATATGGAGATGGAGAA
GATTCTGGGTTGGCACCTGTAGATTTCTTtgtcagtacagtggatccattgaaagagcct
cctctaatcactgcgaatactgttctgtccattcttgccgtggactatccagttgagaag
atttcgtgttacgtgtcagacgatggttcggctatgctcacatttgaatcacttgcggaa
acagcagaatttgctaggagatgggttccattttgcaagaagtactccattgagccacgt
gcccctgagttctacttctcacagaagattgactacttgaaggacaagatacacccatct
ttcgtcaaggagcgtcgggctatgaagAGGGATTACGAAGAATACAAGGTGAGGATAAAT
GCTTTGGTTGCTAAGGCTCAGAAGACACCTGAGGAAGGCTGGATTATGCAAGATGGGACA
CCATGGCCTGGGAACAACCCTCGTGACCACCCTGGAATGATCCAGGTTTTCCTTGGTGAG
ACCGGTGCTCGGGACTTTGACGGAAATGAGCTTCCTCGGCTAGTCTATGTTTCGAGAGAG
AAAAGACCAGGGTACCAACACCACAAGAAAGCAGGGGCCATGAACGCTTTGGTTCGAGTa
tccgcagttctgacaaatgccccttacattcttaatcttgactgtgatcactatgttaac
aatagcaaagctgttcgtgaagcgatgtgtttcatgatggacccttctgttggtagagat
gtctgctatgtccaattcccacaaaggttcgatggcattgatcgcagcgatcgttatgcc
aataggaatgttgtgttctttgacGTTAACATGAAAGGGCTTGATGGCCTCCAAGGTCCG
GTTTATGTGGGAACTGGTTGTTGTTTCTATAGGCAAGCGCTCTATGGTTATGGACCACCA
TCACTGCCTGCGCTTCCAAAGTCTTCTGTCTGTTCATGGTGCTGCTGCTGCTGTCCTAAG
AAAAAAGCTGAAAAAAGTGAGAAAGAAATGCATAGAGACTCTCGACGTGAAGACCTTGAG
TCCGCCATTTTCAATCTTCGGGAAATTGACAACTATGATGAGTATGAACGCTCGATGCTT
ATCTCCCAGATGAGCTTTGAGAAGTCGTTTGGACTGTCATCAGTGTTCATAGAATCAACT
CTTATGGAGAATGGAGGCGTTCCTGAGTCCGCAAACCCATCTACACTGATCAAAGAGGCC
ATTCATGTCATTAGCTGTGGATATGAAGAGAAAACTGAATGGGGAAAAGAGAttggctgg
atctacggttcagtcacagaggatatcctgactgggtttaagatgcactgccgtggctgg
cgatccatctactgcatgccgataagacccgcgttcaagggatcagcgccaatcaacctt
tctgatcgtctccaccaggttctccggtgggctctcggttccgttgagatcttcctcagc
cggcactgcccactctggtacggctacggtggtggtcgtctgaaatggctccagagattg
tcctacatcaacaccatcgtctacccgttcacctctcttcctcttattgcatactgttgc
ctgcccgccatttgcctgctcacaggcaaattcatcattcccacgctctccaacgctgca
accatatggtttcttggcctcttcatctccatcatcgtgacgagcgtcctggagctgcgg
tggagtggcatcggcatcgaggactggtggcgcaacgagcagttctgggtcatcggtggc
gtctccgcccacctcttcgccgtgttccagggtatcctcaagatgattgctgggctggac
accaacttcaccgttacggccaaggcgacggacgacaccgagttcggcgagctgtacgtg
ttcaagtggacgacggtgctgatcccgccgacctccatcctggtgctcaacctcgtcggc
gtggtggccgggttctccgacgcgctcaacagcggctacgagtcctggggcccgctcttc
ggcaaggtgttcttcgccatgtgggtgatcatgcacttgtaccccttcctcaagggtctc
atgggtcgccagaaccggacgcccaccatcgtcgtgctctggtctgtcctgctcgcctcc
gtcttctccctcctctgggtcaagatcgacccgttcatcGGCAGCTCCGAGACCACCACC
ACCAACAGCTGCGCCAACTTCGACTGCTGA

Protein

990 aa

>Os01t0750300-01 Cellulose synthase catalytic subunit, Secondary cell wall formation
MMESGVPPCAACGDDAHAACRACSYALCKACLDEDAAEGRTTCARCGGEYGAPDPAHGQG
AVVEEEVEESHEPAAGGVRERVTMASQLSDHQDEGVHARTMSTHARTISSVSGVGSELND
ESGKPIWKNRVESWKEKKKEKKASAKKAAAKAQAPPVEEQIMDEKDLTDAYEPLSRIIPI
SKNKLTPYRAVIIMRLVVLGLFFHYRITNPVYSAFGLWMTSVICEIWFGFSWILDQFPKW
CPINRETYVDRLIARYGDGEDSGLAPVDFFVSTVDPLKEPPLITANTVLSILAVDYPVEK
ISCYVSDDGSAMLTFESLAETAEFARRWVPFCKKYSIEPRAPEFYFSQKIDYLKDKIHPS
FVKERRAMKRDYEEYKVRINALVAKAQKTPEEGWIMQDGTPWPGNNPRDHPGMIQVFLGE
TGARDFDGNELPRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLTNAPYILNLDCDHYVN
NSKAVREAMCFMMDPSVGRDVCYVQFPQRFDGIDRSDRYANRNVVFFDVNMKGLDGLQGP
VYVGTGCCFYRQALYGYGPPSLPALPKSSVCSWCCCCCPKKKAEKSEKEMHRDSRREDLE
SAIFNLREIDNYDEYERSMLISQMSFEKSFGLSSVFIESTLMENGGVPESANPSTLIKEA
IHVISCGYEEKTEWGKEIGWIYGSVTEDILTGFKMHCRGWRSIYCMPIRPAFKGSAPINL
SDRLHQVLRWALGSVEIFLSRHCPLWYGYGGGRLKWLQRLSYINTIVYPFTSLPLIAYCC
LPAICLLTGKFIIPTLSNAATIWFLGLFISIIVTSVLELRWSGIGIEDWWRNEQFWVIGG
VSAHLFAVFQGILKMIAGLDTNFTVTAKATDDTEFGELYVFKWTTVLIPPTSILVLNLVG
VVAGFSDALNSGYESWGPLFGKVFFAMWVIMHLYPFLKGLMGRQNRTPTIVVLWSVLLAS
VFSLLWVKIDPFIGSSETTTTNSCANFDC*

5'UTR

chr01:31422946..31423076 (+ strand) : 131 bp

CDS

chr01:31423077..31423242 (+ strand) : 166 bp

chr01:31423343..31423452 (+ strand) : 110 bp

chr01:31423550..31423622 (+ strand) : 73 bp

chr01:31423730..31423877 (+ strand) : 148 bp

chr01:31424609..31424875 (+ strand) : 267 bp

chr01:31424976..31425318 (+ strand) : 343 bp

chr01:31425407..31425544 (+ strand) : 138 bp

chr01:31426131..31426256 (+ strand) : 126 bp

chr01:31426368..31426580 (+ strand) : 213 bp

chr01:31426660..31426906 (+ strand) : 247 bp

chr01:31426989..31427188 (+ strand) : 200 bp

chr01:31427280..31427633 (+ strand) : 354 bp

chr01:31427726..31428310 (+ strand) : 585 bp

3'UTR

chr01:31428311..31428670 (+ strand) : 360 bp

FASTA

>Os01t0750300-01 class=Sequence position=chr01:31422946..31428670 (+ strand)
AGCCTCTCTC TCTCTCCCCC TCCCATTCTG CGCATTGCTC TCTGCGCGCG GTCGCGTGCT GCTGCTCGCG GCGCCCCGGA
GCGTCTCCTT TGGGGGAGAG GAGAGGAGAG GAGAGGAGAG GGGGGTGAGC CATGATGGAG TCGGGGGTCC CGCCCTGCGC
CGCGTGCGGG GACGACGCGC ACGCCGCCTG CCGCGCCTGC AGCTACGCGC TCTGCAAGGC CTGCCTCGAC GAGGACGCCG
CCGAGGGACG CACCACCTGC GCGCGCTGCG GCGGGGAGTA CGGCGCGCCC GACCCAGGTG CCCCCGCGCG CTGCGGGTTA
CTGTTTTGCC CTATGCGGGA TTCGATCGAT GCGGGGGATG AAGTAGCAGT TTCTGACGAG GTTGATCTCT GTCACAGCGC
ATGGCCAGGG GGCGGTCGTG GAGGAGGAAG TGGAAGAGAG CCACGAGCCG GCGGCCGGCG GTGTTCGCGA GAGGGTCACC
ATGGCCAGCC AACTCAGCGA TCACCAGGTG AATAGCCCTC TCCATAAACT CGTGCAATTC TGGGTAGAAC AGCTTGAGCG
CTCCGACGTT GTTGACAATG TTGTGTGGGA TTTTGTGGGA ACAGGATGAA GGAGTTCATG CCAGGACTAT GAGCACCCAT
GCCAGGACAA TTAGCAGTGT CTCTGGAGTT GGGAGTGGTA AGCAACTCGT CTCGTTGTCT GTCATATTTT TCCTTGCATT
ATTCCAACTG AGTACTGATA TATATATATA TATATATATA TTTTCACTTG TTATGGATTT GAAGAATTGA ATGATGAATC
TGGGAAGCCC ATCTGGAAGA ACAGGGTGGA GAGCTGGAAG GAGAAAAAGA AAGAGAAGAA AGCCTCAGCA AAGAAAGCTG
CAGCAAAAGC TCAAGCTCCA CCTGTTGAAG AACAGATTAT GGATGAAAAA GAGTAAGGAA CATGGAACCA TTTCATAGAT
CCATGTGATC CATCAAAAAC TTAACATTTC TTGATTCATA TACATTATTT ACAGTTACAA ATGAAAATTC TTGTGTATAT
TAAAATATAT CTGATTAGAT CAATAGGCTA AGAATACTCT TGATCCTTGT TGACATATAA AAAAACAAAC TTTATGGTTT
GGGTAAATTT AGAATCTGGC TATATCTAAC CTTTTCTTTG AATGTACTAG ATGCCAGATC ATGTGCATTT AGAACTGAAC
TTGTTGTCTT ATGCAGACGT TATTCGTTTA GAACTGAACT AATAAATCCC TAATGCAGAT ATTATCTCAC AATGCTAAAA
TATAAAACGT CTAATTGGAT TACTACAGAA AAACCCTTTA GCTAATTTCG AGATCAGCAT ATGTAGTCAA TCTTAAGTTC
TTAACACATC ATATTTCATA CTTCATTAAT AAGGTTTCAT TTTGGTGCAG CTTATCTTTT TCTGGTATAA CACTAGGCCT
TCTTATTTTG TGATGCGAAC AGTACATGTT CATCTTTGTT CCTCCAGTAT ACTATCCTAG CCTATTATGC AACCTTTTTA
ACTTCGTGTT CATATCCTGA TAATGTGCCA GTAAAGTCTC AGTTTCAGAA ACTCTTGTTA CTTCAGGTTT TAAATGCTGA
TTGTTGACAT AACACTGTAC TTGGAGAATT GATTGTAATA CCAAGCAATT TGCCCTTTTG CAGCTTGACA GATGCATATG
AGCCACTTTC TCGGATCATT CCTATATCGA AGAACAAGCT CACACCTTAC AGGGCAGTAA TCATTATGCG TCTGGTAGTT
CTGGGGCTCT TCTTTCACTA CCGTATCACC AACCCTGTTT ACAGCGCCTT TGGTCTCTGG ATGACATCAG TCATATGTGA
GATCTGGTTT GGATTCTCCT GGATCCTGGA TCAGTTCCCC AAGTGGTGTC CTATCAATCG CGAAACTTAT GTTGATAGGC
TGATTGCACG GTGTGTTCGC TAAAGCCTAA TTTGTATATG AAAACTATAT ACATTACTAT TCATTAAGAA TTTGTGTCTC
ATAAGCTGCA TTGCTCATGT GTTGTTTCAG ATATGGAGAT GGAGAAGATT CTGGGTTGGC ACCTGTAGAT TTCTTtgtca
gtacagtgga tccattgaaa gagcctcctc taatcactgc gaatactgtt ctgtccattc ttgccgtgga ctatccagtt
gagaagattt cgtgttacgt gtcagacgat ggttcggcta tgctcacatt tgaatcactt gcggaaacag cagaatttgc
taggagatgg gttccatttt gcaagaagta ctccattgag ccacgtgccc ctgagttcta cttctcacag aagattgact
acttgaagga caagatacac ccatctttcg tcaaggagcg tcgggctatg aaggtagata ggagtttaTA CAGTTTGATG
GTGCTCTTTA TGTTATATTG TACTTTTGCT AATATTAAAG CAACTATCAC ATTTTGTGCA GAGGGATTAC GAAGAATACA
AGGTGAGGAT AAATGCTTTG GTTGCTAAGG CTCAGAAGAC ACCTGAGGAA GGCTGGATTA TGCAAGATGG GACACCATGG
CCTGGGAACA ACCCTCGTGA CCACCCTGGA ATGATCCAGG TAATTCAGTT TTCATTACCA AAACATCAAT CTTGGATATT
TGTTCTTGTA TTCATACCGG GCAACCTTTT ACAGATTTGC AAGTTTGTAA TTCTCACCTG AAAACGGGAT AGTTTCTGGT
GTACAAAAGT TAAGAATAAA TGAAGTTTAG GTTGCCACTT GGAGTAGAGA TTCTATTGAC TTCTGCTTTG AAACAAAATA
TGTCAAGTGT TAACTATTGT TTGCATGCAG AAAACCAGGA GAGAAAGTCT AATCCTATGC AGTTCCACTT TAAGATTTTC
GCAGATAATA TATGTCATAC AACTTCAATT GATTATCGAT ATGCTCATTC TTGTTGTCCA GGAGATTGTG CATAAATTCT
ATCCTACTCT TCAGGATGCA GTTAATTAAA ATTATGTCAT TAGAGTAACT CAAGGTTTTA CAGATTTATT AGTAAAATGG
TTCAAATGTT TTGTGGAGCC CCCTCTCTCT CACACACTCA CATATGGCTT TTTATACTTG CATCAAAACC AAGACATAGA
TAACATGCAG ACGATAGCCT ATTCTTCAAA CTTACACTTA GCATACCACT GGCTTTTTGT AACAGGTTTT CCTTGGTGAG
ACCGGTGCTC GGGACTTTGA CGGAAATGAG CTTCCTCGGC TAGTCTATGT TTCGAGAGAG AAAAGACCAG GGTACCAACA
CCACAAGAAA GCAGGGGCCA TGAACGCTTT GGTAAAAATA GCTCCTAGAG AAAATTACAC ATATATGTAT TAGTTTAAAG
TATGGCAAAC TTATCATGTG GATATAGTAA TTGAAAGTTT GGTCACCTTT CTAATTTTTC AGGTTCGAGT atccgcagtt
ctgacaaatg ccccttacat tcttaatctt gactgtgatc actatgttaa caatagcaaa gctgttcgtg aagcgatgtg
tttcatgatg gacccttctg ttggtagaga tgtctgctat gtccaattcc cacaaaggtt cgatggcatt gatcgcagcg
atcgttatgc caataggaat gttgtgttct ttgacgtAAG TACTAAGAGA GTGACTATGT ATTGCATGAC TATTATCTTT
ACCCAATTTA TATATTCATA CTTATCATCT GCAGGTTAAC ATGAAAGGGC TTGATGGCCT CCAAGGTCCG GTTTATGTGG
GAACTGGTTG TTGTTTCTAT AGGCAAGCGC TCTATGGTTA TGGACCACCA TCACTGCCTG CGCTTCCAAA GTCTTCTGTC
TGTTCATGGT GCTGCTGCTG CTGTCCTAAG AAAAAAGCTG AAAAAAGTGA GAAAGAAATG CATAGAGACT CTCGACGTGA
AGACCTTGAG TCCGCCATTT TCAATCTTCG GGAAATTGAC AGTAAGTGCA CAAACATGGA GAGATAAAAG TAGTTCGAAA
TTTGAATAAT TTTGTGTTCA TTATAATGTG GTTTGTTTTG CAGACTATGA TGAGTATGAA CGCTCGATGC TTATCTCCCA
GATGAGCTTT GAGAAGTCGT TTGGACTGTC ATCAGTGTTC ATAGAATCAA CTCTTATGGA GAATGGAGGC GTTCCTGAGT
CCGCAAACCC ATCTACACTG ATCAAAGAGG CCATTCATGT CATTAGCTGT GGATATGAAG AGAAAACTGA ATGGGGAAAA
GAGGTGTTAA TTCTCCCCTT ATTATCTATA CCTTTGTTGA AGTTCATTCC TCCTAAAACT CAAAGCGTGA TTTCTTGGTT
CTGTCCTGTC ATAGAttggc tggatctacg gttcagtcac agaggatatc ctgactgggt ttaagatgca ctgccgtggc
tggcgatcca tctactgcat gccgataaga cccgcgttca agggatcagc gccaatcaac ctttctgatc gtctccacca
ggttctccgg tgggctctcg gttccgttga gatcttcctc agccggcact gcccactctg gtacggctac ggtggtggtc
gtctgaaatg gctccagaga ttgtcctaca tcaacaccat cgtctacccg ttcacctctc ttcctcttat tgcatactgt
tgcctgcccg ccatttgcct gctcacaggc aaattcatca ttcccacggt aagatgcctg tctctataca tgtttttggt
ttgagttctg atgttgaaca ttgcttagtg acattattca tttgtcgttc ttaatttcag ctctccaacg ctgcaaccat
atggtttctt ggcctcttca tctccatcat cgtgacgagc gtcctggagc tgcggtggag tggcatcggc atcgaggact
ggtggcgcaa cgagcagttc tgggtcatcg gtggcgtctc cgcccacctc ttcgccgtgt tccagggtat cctcaagatg
attgctgggc tggacaccaa cttcaccgtt acggccaagg cgacggacga caccgagttc ggcgagctgt acgtgttcaa
gtggacgacg gtgctgatcc cgccgacctc catcctggtg ctcaacctcg tcggcgtggt ggccgggttc tccgacgcgc
tcaacagcgg ctacgagtcc tggggcccgc tcttcggcaa ggtgttcttc gccatgtggg tgatcatgca cttgtacccc
ttcctcaagg gtctcatggg tcgccagaac cggacgccca ccatcgtcgt gctctggtct gtcctgctcg cctccgtctt
ctccctcctc tgggtcaaga tcgacccgtt catcGGCAGC TCCGAGACCA CCACCACCAA CAGCTGCGCC AACTTCGACT
GCTGAGCGAC ATTTGTGCTC CAGGAGCATC CCGTTTGGCG GTGTTTTGCC GGTATTGCAA ATGTGTGTAT CTAATGCGAC
GAAGACGATG GGTGGTTTCC TCTCTCTGGG CTTTGTCCTC GATCTGAGAG GTGTTGTAGG TTAGTACTCC GCATGAAAAT
GTTCATTGTA TTGTTATTGT CTGTGATATA AGAAGTTTTG ATGTTGAAGC CGCTGAAACT ATGAGAGGGC ACCGTTAAAT
CCGTTTAATC ATACTTGTAG AAAAAAGAGG GGGAAAGAAA AGGTTTTCTT CGGTGAACTT GAAATTGGAC TACTGATCAG
TTTGTAATGT TATATGACTA TATGCTACTG AATCTTATCT TATGC

Locus: Os01g0750300

Loading...

Locus: Os01g0750300

Loading...