Os01t0750300-02

Locus

Os01g0750300

Description

Similar to cDNA clone:J023093O20, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BC7

CGSNL Gene Name

BRITTLE CULM 7

Oryzabase Gene Symbol Synonym(s)

OsCesA4, OsCESA4, CESA4, OS_CESA04, BC11, bc7t, Bc7(t), bc-7, OsCesA 4, CesA4, FC17/CESA4, FC17, OsFC17

Oryzabase Gene Name Synonym(s)

Cellulose synthase A catalytic subunit 4 [UDP-forming], Cellulose synthase A catalytic subunit 4, brittle culm 7, brittle culm11, fragile culm 17

Transcript Evidence

AK100374 (DDBJ, Best hit)

Protein Evidence

B7EQH8 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

J023084J22 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0750300-02)

Others

Oryzabase (8926)

Transcript

2024 bp

>Os01t0750300-02 Similar to cDNA clone:J023093O20, full insert sequence.
GTCTATGTTTCGAGAGAGAAAAGACCAGGGTACCAACACCACAAGAAAGCAGGGGCCATG
AACGCTTTGGTTCGAGTatccgcagttctgacaaatgccccttacattcttaatcttgac
tgtgatcactatgttaacaatagcaaagctgttcgtgaagcgatgtgtttcatgatggac
ccttctgttggtagagatgtctgctatgtccaattcccacaaaggttcgatggcattgat
cgcagcgatcgttatgccaataggaatgttgtgttctttgacGTTAACATGAAAGGGCTT
GATGGCCTCCAAGGTCCGGTTTATGTGGGAACTGGTTGTTGTTTCTATAGGCAAGCGCTC
TATGGTTATGGACCACCATCACTGCCTGCGCTTCCAAAGTCTTCTGTCTGTTCATGGTGC
TGCTGCTGCTGTCCTAAGAAAAAAGCTGAAAAAAGTGAGAAAGAAATGCATAGAGACTCT
CGACGTGAAGACCTTGAGTCCGCCATTTTCAATCTTCGGGAAATTGACAACTATGATGAG
TATGAACGCTCGATGCTTATCTCCCAGATGAGCTTTGAGAAGTCGTTTGGACTGTCATCA
GTGTTCATAGAATCAACTCTTATGGAGAATGGAGGCGTTCCTGAGTCCGCAAACCCATCT
ACACTGATCAAAGAGGCCATTCATGTCATTAGCTGTGGATATGAAGAGAAAACTGAATGG
GGAAAAGAGAttggctggatctacggttcagtcacagaggatatcctgactgggtttaag
atgcactgccgtggctggcgatccatctactgcatgccgataagacccgcgttcaaggga
tcagcgccaatcaacctttctgatcgtctccaccaggttctccggtgggctctcggttcc
gttgagatcttcctcagccggcactgcccactctggtacggctacggtggtggtcgtctg
aaatggctccagagattgtcctacatcaacaccatcgtctacccgttcacctctcttcct
cttattgcatactgttgcctgcccgccatttgcctgctcacaggcaaattcatcattccc
acgctctccaacgctgcaaccatatggtttcttggcctcttcatctccatcatcgtgacg
agcgtcctggagctgcggtggagtggcatcggcatcgaggactggtggcgcaacgagcag
ttctgggtcatcggtggcgtctccgcccacctcttcgccgtgttccagggtatcctcaag
atgattgctgggctggacaccaacttcaccgttacggccaaggcgacggacgacaccgag
ttcggcgagctgtacgtgttcaagtggacgacggtgctgatcccgccgacctccatcctg
gtgctcaacctcgtcggcgtggtggccgggttctccgacgcgctcaacagcggctacgag
tcctggggcccgctcttcggcaaggtgttcttcgccatgtgggtgatcatgcacttgtac
cccttcctcaagggtctcatgggtcgccagaaccggacgcccaccatcgtcgtgctctgg
tctgtcctgctcgcctccgtcttctccctcctctgggtcaagatcgacccgttcatcGGC
AGCTCCGAGACCACCACCACCAACAGCTGCGCCAACTTCGACTGCTGAGCGACATTTGTG
CTCCAGGAGCATCCCGTTTGGCGGTGTTTTGCCGGTATTGCAAATGTGTGTATCTAATGC
GACGAAGACGATGGGTGGTTTCCTCTCTCTGGGCTTTGTCCTCGATCTGAGAGGTGTTGT
AGGTTAGTACTCCGCATGAAAATGTTCATTGTATTGTTATTGTCTGTGATATAAGAAGTT
TTGATGTTGAAGCCGCTGAAACTATGAGAGGGCACCGTTAAATCCGTTTAATCATACTTG
TAGAAAAAAGAGGGGGAAAGAAAAGGTTTTCTTCGGTGAACTTGAAATTGGACTACTGAT
CAGTTTGTAATGTTATATGACTATATGCTACTGAATCTTATCTT

CDS

1611 bp

>Os01t0750300-02 Similar to cDNA clone:J023093O20, full insert sequence.
ATGAACGCTTTGGTTCGAGTatccgcagttctgacaaatgccccttacattcttaatctt
gactgtgatcactatgttaacaatagcaaagctgttcgtgaagcgatgtgtttcatgatg
gacccttctgttggtagagatgtctgctatgtccaattcccacaaaggttcgatggcatt
gatcgcagcgatcgttatgccaataggaatgttgtgttctttgacGTTAACATGAAAGGG
CTTGATGGCCTCCAAGGTCCGGTTTATGTGGGAACTGGTTGTTGTTTCTATAGGCAAGCG
CTCTATGGTTATGGACCACCATCACTGCCTGCGCTTCCAAAGTCTTCTGTCTGTTCATGG
TGCTGCTGCTGCTGTCCTAAGAAAAAAGCTGAAAAAAGTGAGAAAGAAATGCATAGAGAC
TCTCGACGTGAAGACCTTGAGTCCGCCATTTTCAATCTTCGGGAAATTGACAACTATGAT
GAGTATGAACGCTCGATGCTTATCTCCCAGATGAGCTTTGAGAAGTCGTTTGGACTGTCA
TCAGTGTTCATAGAATCAACTCTTATGGAGAATGGAGGCGTTCCTGAGTCCGCAAACCCA
TCTACACTGATCAAAGAGGCCATTCATGTCATTAGCTGTGGATATGAAGAGAAAACTGAA
TGGGGAAAAGAGAttggctggatctacggttcagtcacagaggatatcctgactgggttt
aagatgcactgccgtggctggcgatccatctactgcatgccgataagacccgcgttcaag
ggatcagcgccaatcaacctttctgatcgtctccaccaggttctccggtgggctctcggt
tccgttgagatcttcctcagccggcactgcccactctggtacggctacggtggtggtcgt
ctgaaatggctccagagattgtcctacatcaacaccatcgtctacccgttcacctctctt
cctcttattgcatactgttgcctgcccgccatttgcctgctcacaggcaaattcatcatt
cccacgctctccaacgctgcaaccatatggtttcttggcctcttcatctccatcatcgtg
acgagcgtcctggagctgcggtggagtggcatcggcatcgaggactggtggcgcaacgag
cagttctgggtcatcggtggcgtctccgcccacctcttcgccgtgttccagggtatcctc
aagatgattgctgggctggacaccaacttcaccgttacggccaaggcgacggacgacacc
gagttcggcgagctgtacgtgttcaagtggacgacggtgctgatcccgccgacctccatc
ctggtgctcaacctcgtcggcgtggtggccgggttctccgacgcgctcaacagcggctac
gagtcctggggcccgctcttcggcaaggtgttcttcgccatgtgggtgatcatgcacttg
taccccttcctcaagggtctcatgggtcgccagaaccggacgcccaccatcgtcgtgctc
tggtctgtcctgctcgcctccgtcttctccctcctctgggtcaagatcgacccgttcatc
GGCAGCTCCGAGACCACCACCACCAACAGCTGCGCCAACTTCGACTGCTGA

Protein

537 aa

>Os01t0750300-02 Similar to cDNA clone:J023093O20, full insert sequence.
MNALVRVSAVLTNAPYILNLDCDHYVNNSKAVREAMCFMMDPSVGRDVCYVQFPQRFDGI
DRSDRYANRNVVFFDVNMKGLDGLQGPVYVGTGCCFYRQALYGYGPPSLPALPKSSVCSW
CCCCCPKKKAEKSEKEMHRDSRREDLESAIFNLREIDNYDEYERSMLISQMSFEKSFGLS
SVFIESTLMENGGVPESANPSTLIKEAIHVISCGYEEKTEWGKEIGWIYGSVTEDILTGF
KMHCRGWRSIYCMPIRPAFKGSAPINLSDRLHQVLRWALGSVEIFLSRHCPLWYGYGGGR
LKWLQRLSYINTIVYPFTSLPLIAYCCLPAICLLTGKFIIPTLSNAATIWFLGLFISIIV
TSVLELRWSGIGIEDWWRNEQFWVIGGVSAHLFAVFQGILKMIAGLDTNFTVTAKATDDT
EFGELYVFKWTTVLIPPTSILVLNLVGVVAGFSDALNSGYESWGPLFGKVFFAMWVIMHL
YPFLKGLMGRQNRTPTIVVLWSVLLASVFSLLWVKIDPFIGSSETTTTNSCANFDC*

5'UTR

chr01:31426188..31426244 (+ strand) : 57 bp

CDS

chr01:31426245..31426256 (+ strand) : 12 bp

chr01:31426368..31426580 (+ strand) : 213 bp

chr01:31426660..31426906 (+ strand) : 247 bp

chr01:31426989..31427188 (+ strand) : 200 bp

chr01:31427280..31427633 (+ strand) : 354 bp

chr01:31427726..31428310 (+ strand) : 585 bp

3'UTR

chr01:31428311..31428666 (+ strand) : 356 bp

FASTA

>Os01t0750300-02 class=Sequence position=chr01:31426188..31428666 (+ strand)
GTCTATGTTT CGAGAGAGAA AAGACCAGGG TACCAACACC ACAAGAAAGC AGGGGCCATG AACGCTTTGG TAAAAATAGC
TCCTAGAGAA AATTACACAT ATATGTATTA GTTTAAAGTA TGGCAAACTT ATCATGTGGA TATAGTAATT GAAAGTTTGG
TCACCTTTCT AATTTTTCAG GTTCGAGTat ccgcagttct gacaaatgcc ccttacattc ttaatcttga ctgtgatcac
tatgttaaca atagcaaagc tgttcgtgaa gcgatgtgtt tcatgatgga cccttctgtt ggtagagatg tctgctatgt
ccaattccca caaaggttcg atggcattga tcgcagcgat cgttatgcca ataggaatgt tgtgttcttt gacgtAAGTA
CTAAGAGAGT GACTATGTAT TGCATGACTA TTATCTTTAC CCAATTTATA TATTCATACT TATCATCTGC AGGTTAACAT
GAAAGGGCTT GATGGCCTCC AAGGTCCGGT TTATGTGGGA ACTGGTTGTT GTTTCTATAG GCAAGCGCTC TATGGTTATG
GACCACCATC ACTGCCTGCG CTTCCAAAGT CTTCTGTCTG TTCATGGTGC TGCTGCTGCT GTCCTAAGAA AAAAGCTGAA
AAAAGTGAGA AAGAAATGCA TAGAGACTCT CGACGTGAAG ACCTTGAGTC CGCCATTTTC AATCTTCGGG AAATTGACAG
TAAGTGCACA AACATGGAGA GATAAAAGTA GTTCGAAATT TGAATAATTT TGTGTTCATT ATAATGTGGT TTGTTTTGCA
GACTATGATG AGTATGAACG CTCGATGCTT ATCTCCCAGA TGAGCTTTGA GAAGTCGTTT GGACTGTCAT CAGTGTTCAT
AGAATCAACT CTTATGGAGA ATGGAGGCGT TCCTGAGTCC GCAAACCCAT CTACACTGAT CAAAGAGGCC ATTCATGTCA
TTAGCTGTGG ATATGAAGAG AAAACTGAAT GGGGAAAAGA GGTGTTAATT CTCCCCTTAT TATCTATACC TTTGTTGAAG
TTCATTCCTC CTAAAACTCA AAGCGTGATT TCTTGGTTCT GTCCTGTCAT AGAttggctg gatctacggt tcagtcacag
aggatatcct gactgggttt aagatgcact gccgtggctg gcgatccatc tactgcatgc cgataagacc cgcgttcaag
ggatcagcgc caatcaacct ttctgatcgt ctccaccagg ttctccggtg ggctctcggt tccgttgaga tcttcctcag
ccggcactgc ccactctggt acggctacgg tggtggtcgt ctgaaatggc tccagagatt gtcctacatc aacaccatcg
tctacccgtt cacctctctt cctcttattg catactgttg cctgcccgcc atttgcctgc tcacaggcaa attcatcatt
cccacggtaa gatgcctgtc tctatacatg tttttggttt gagttctgat gttgaacatt gcttagtgac attattcatt
tgtcgttctt aatttcagct ctccaacgct gcaaccatat ggtttcttgg cctcttcatc tccatcatcg tgacgagcgt
cctggagctg cggtggagtg gcatcggcat cgaggactgg tggcgcaacg agcagttctg ggtcatcggt ggcgtctccg
cccacctctt cgccgtgttc cagggtatcc tcaagatgat tgctgggctg gacaccaact tcaccgttac ggccaaggcg
acggacgaca ccgagttcgg cgagctgtac gtgttcaagt ggacgacggt gctgatcccg ccgacctcca tcctggtgct
caacctcgtc ggcgtggtgg ccgggttctc cgacgcgctc aacagcggct acgagtcctg gggcccgctc ttcggcaagg
tgttcttcgc catgtgggtg atcatgcact tgtacccctt cctcaagggt ctcatgggtc gccagaaccg gacgcccacc
atcgtcgtgc tctggtctgt cctgctcgcc tccgtcttct ccctcctctg ggtcaagatc gacccgttca tcGGCAGCTC
CGAGACCACC ACCACCAACA GCTGCGCCAA CTTCGACTGC TGAGCGACAT TTGTGCTCCA GGAGCATCCC GTTTGGCGGT
GTTTTGCCGG TATTGCAAAT GTGTGTATCT AATGCGACGA AGACGATGGG TGGTTTCCTC TCTCTGGGCT TTGTCCTCGA
TCTGAGAGGT GTTGTAGGTT AGTACTCCGC ATGAAAATGT TCATTGTATT GTTATTGTCT GTGATATAAG AAGTTTTGAT
GTTGAAGCCG CTGAAACTAT GAGAGGGCAC CGTTAAATCC GTTTAATCAT ACTTGTAGAA AAAAGAGGGG GAAAGAAAAG
GTTTTCTTCG GTGAACTTGA AATTGGACTA CTGATCAGTT TGTAATGTTA TATGACTATA TGCTACTGAA TCTTATCTT

Locus: Os01g0750300

Loading...

Locus: Os01g0750300

Loading...