Os01t0750300-03

Locus

Os01g0750300

Description

Similar to cDNA clone:J023093O20, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BC7

CGSNL Gene Name

BRITTLE CULM 7

Oryzabase Gene Symbol Synonym(s)

OsCesA4, OsCESA4, CESA4, OS_CESA04, BC11, bc7t, Bc7(t), bc-7, OsCesA 4, CesA4, FC17/CESA4, FC17, OsFC17

Oryzabase Gene Name Synonym(s)

Cellulose synthase A catalytic subunit 4 [UDP-forming], Cellulose synthase A catalytic subunit 4, brittle culm 7, brittle culm11, fragile culm 17

Transcript Evidence

AK105078 (DDBJ, Best hit)

Protein Evidence

B7EQH8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

001-045-G07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0750300-03)

RiceXPro (AK105078)

Others

Oryzabase (8926)

KEGG (Os01t0750300-03 (EC:2.4.1.12))

Transcript

1505 bp

>Os01t0750300-03 Similar to cDNA clone:J023093O20, full insert sequence.
AGTGAGAAAGAAATGCATAGAGACTCTCGACGTGAAGACCTTGAGTCCGCCATTTTCAAT
CTTCGGGAAATTGACAACTATGATGAGTATGAACGCTCGATGCTTATCTCCCAGATGAGC
TTTGAGAAGTCGTTTGGACTGTCATCAGTGTTCATAGAATCAACTCTTATGGAGAATGGA
GGCGTTCCTGAGTCCGCAAACCCATCTACACTGATCAAAGAGGCCATTCATGTCATTAGC
TGTGGATATGAAGAGAAAACTGAATGGGGAAAAGAGAttggctggatctacggttcagtc
acagaggatatcctgactgggtttaagatgcactgccgtggctggcgatccatctactgc
atgccgataagacccgcgttcaagggatcagcgccaatcaacctttctgatcgtctccac
caggttctccggtgggctctcggttccgttgagatcttcctcagccggcactgcccactc
tggtacggctacggtggtggtcgtctgaaatggctccagagattgtcctacatcaacacc
atcgtctacccgttcacctctcttcctcttattgcatactgttgcctgcccgccatttgc
ctgctcacaggcaaattcatcattcccacgctctccaacgctgcaaccatatggtttctt
ggcctcttcatctccatcatcgtgacgagcgtcctggagctgcggtggagtggcatcggc
atcgaggactggtggcgcaacgagcagttctgggtcatcggtggcgtctccgcccacctc
ttcgccgtgttccagggtatcctcaagatgattgctgggctggacaccaacttcaccgtt
acggccaaggcgacggacgacaccgagttcggcgagctgtacgtgttcaagtggacgacg
gtgctgatcccgccgacctccatcctggtgctcaacctcgtcggcgtggtggccgggttc
tccgacgcgctcaacagcggctacgagtcctggggcccgctcttcggcaaggtgttcttc
gccatgtgggtgatcatgcacttgtaccccttcctcaagggtctcatgggtcgccagaac
cggacgcccaccatcgtcgtgctctggtctgtcctgctcgcctccgtcttctccctcctc
tgggtcaagatcgacccgttcatcGGCAGCTCCGAGACCACCACCACCAACAGCTGCGCC
AACTTCGACTGCTGAGCGACATTTGTGCTCCAGGAGCATCCCGTTTGGCGGTGTTTTGCC
GGTATTGCAAATGTGTGTATCTAATGCGACGAAGACGATGGGTGGTTTCCTCTCTCTGGG
CTTTGTCCTCGATCTGAGAGGTGTTGTAGGTTAGTACTCCGCATGAAAATGTTCATTGTA
TTGTTATTGTCTGTGATATAAGAAGTTTTGATGTTGAAGCCGCTGAAACTATGAGAGGGC
ACCGTTAAATCCGTTTAATCATACTTGTAGAAAAAAGAGGGGGAAAGAAAAGGTTTTCTT
CGGTG

CDS

1215 bp

>Os01t0750300-03 Similar to cDNA clone:J023093O20, full insert sequence.
AGTGAGAAAGAAATGCATAGAGACTCTCGACGTGAAGACCTTGAGTCCGCCATTTTCAAT
CTTCGGGAAATTGACAACTATGATGAGTATGAACGCTCGATGCTTATCTCCCAGATGAGC
TTTGAGAAGTCGTTTGGACTGTCATCAGTGTTCATAGAATCAACTCTTATGGAGAATGGA
GGCGTTCCTGAGTCCGCAAACCCATCTACACTGATCAAAGAGGCCATTCATGTCATTAGC
TGTGGATATGAAGAGAAAACTGAATGGGGAAAAGAGAttggctggatctacggttcagtc
acagaggatatcctgactgggtttaagatgcactgccgtggctggcgatccatctactgc
atgccgataagacccgcgttcaagggatcagcgccaatcaacctttctgatcgtctccac
caggttctccggtgggctctcggttccgttgagatcttcctcagccggcactgcccactc
tggtacggctacggtggtggtcgtctgaaatggctccagagattgtcctacatcaacacc
atcgtctacccgttcacctctcttcctcttattgcatactgttgcctgcccgccatttgc
ctgctcacaggcaaattcatcattcccacgctctccaacgctgcaaccatatggtttctt
ggcctcttcatctccatcatcgtgacgagcgtcctggagctgcggtggagtggcatcggc
atcgaggactggtggcgcaacgagcagttctgggtcatcggtggcgtctccgcccacctc
ttcgccgtgttccagggtatcctcaagatgattgctgggctggacaccaacttcaccgtt
acggccaaggcgacggacgacaccgagttcggcgagctgtacgtgttcaagtggacgacg
gtgctgatcccgccgacctccatcctggtgctcaacctcgtcggcgtggtggccgggttc
tccgacgcgctcaacagcggctacgagtcctggggcccgctcttcggcaaggtgttcttc
gccatgtgggtgatcatgcacttgtaccccttcctcaagggtctcatgggtcgccagaac
cggacgcccaccatcgtcgtgctctggtctgtcctgctcgcctccgtcttctccctcctc
tgggtcaagatcgacccgttcatcGGCAGCTCCGAGACCACCACCACCAACAGCTGCGCC
AACTTCGACTGCTGA

Protein

405 aa

>Os01t0750300-03 Similar to cDNA clone:J023093O20, full insert sequence.
SEKEMHRDSRREDLESAIFNLREIDNYDEYERSMLISQMSFEKSFGLSSVFIESTLMENG
GVPESANPSTLIKEAIHVISCGYEEKTEWGKEIGWIYGSVTEDILTGFKMHCRGWRSIYC
MPIRPAFKGSAPINLSDRLHQVLRWALGSVEIFLSRHCPLWYGYGGGRLKWLQRLSYINT
IVYPFTSLPLIAYCCLPAICLLTGKFIIPTLSNAATIWFLGLFISIIVTSVLELRWSGIG
IEDWWRNEQFWVIGGVSAHLFAVFQGILKMIAGLDTNFTVTAKATDDTEFGELYVFKWTT
VLIPPTSILVLNLVGVVAGFSDALNSGYESWGPLFGKVFFAMWVIMHLYPFLKGLMGRQN
RTPTIVVLWSVLLASVFSLLWVKIDPFIGSSETTTTNSCANFDC*

CDS

chr01:31426831..31426906 (+ strand) : 76 bp

chr01:31426989..31427188 (+ strand) : 200 bp

chr01:31427280..31427633 (+ strand) : 354 bp

chr01:31427726..31428310 (+ strand) : 585 bp

3'UTR

chr01:31428311..31428600 (+ strand) : 290 bp

FASTA

>Os01t0750300-03 class=Sequence position=chr01:31426831..31428600 (+ strand)
AGTGAGAAAG AAATGCATAG AGACTCTCGA CGTGAAGACC TTGAGTCCGC CATTTTCAAT CTTCGGGAAA TTGACAGTAA
GTGCACAAAC ATGGAGAGAT AAAAGTAGTT CGAAATTTGA ATAATTTTGT GTTCATTATA ATGTGGTTTG TTTTGCAGAC
TATGATGAGT ATGAACGCTC GATGCTTATC TCCCAGATGA GCTTTGAGAA GTCGTTTGGA CTGTCATCAG TGTTCATAGA
ATCAACTCTT ATGGAGAATG GAGGCGTTCC TGAGTCCGCA AACCCATCTA CACTGATCAA AGAGGCCATT CATGTCATTA
GCTGTGGATA TGAAGAGAAA ACTGAATGGG GAAAAGAGGT GTTAATTCTC CCCTTATTAT CTATACCTTT GTTGAAGTTC
ATTCCTCCTA AAACTCAAAG CGTGATTTCT TGGTTCTGTC CTGTCATAGA ttggctggat ctacggttca gtcacagagg
atatcctgac tgggtttaag atgcactgcc gtggctggcg atccatctac tgcatgccga taagacccgc gttcaaggga
tcagcgccaa tcaacctttc tgatcgtctc caccaggttc tccggtgggc tctcggttcc gttgagatct tcctcagccg
gcactgccca ctctggtacg gctacggtgg tggtcgtctg aaatggctcc agagattgtc ctacatcaac accatcgtct
acccgttcac ctctcttcct cttattgcat actgttgcct gcccgccatt tgcctgctca caggcaaatt catcattccc
acggtaagat gcctgtctct atacatgttt ttggtttgag ttctgatgtt gaacattgct tagtgacatt attcatttgt
cgttcttaat ttcagctctc caacgctgca accatatggt ttcttggcct cttcatctcc atcatcgtga cgagcgtcct
ggagctgcgg tggagtggca tcggcatcga ggactggtgg cgcaacgagc agttctgggt catcggtggc gtctccgccc
acctcttcgc cgtgttccag ggtatcctca agatgattgc tgggctggac accaacttca ccgttacggc caaggcgacg
gacgacaccg agttcggcga gctgtacgtg ttcaagtgga cgacggtgct gatcccgccg acctccatcc tggtgctcaa
cctcgtcggc gtggtggccg ggttctccga cgcgctcaac agcggctacg agtcctgggg cccgctcttc ggcaaggtgt
tcttcgccat gtgggtgatc atgcacttgt accccttcct caagggtctc atgggtcgcc agaaccggac gcccaccatc
gtcgtgctct ggtctgtcct gctcgcctcc gtcttctccc tcctctgggt caagatcgac ccgttcatcG GCAGCTCCGA
GACCACCACC ACCAACAGCT GCGCCAACTT CGACTGCTGA GCGACATTTG TGCTCCAGGA GCATCCCGTT TGGCGGTGTT
TTGCCGGTAT TGCAAATGTG TGTATCTAAT GCGACGAAGA CGATGGGTGG TTTCCTCTCT CTGGGCTTTG TCCTCGATCT
GAGAGGTGTT GTAGGTTAGT ACTCCGCATG AAAATGTTCA TTGTATTGTT ATTGTCTGTG ATATAAGAAG TTTTGATGTT
GAAGCCGCTG AAACTATGAG AGGGCACCGT TAAATCCGTT TAATCATACT TGTAGAAAAA AGAGGGGGAA AGAAAAGGTT
TTCTTCGGTG 

Locus: Os01g0750300

Loading...

Locus: Os01g0750300

Loading...