Os01t0751600-01

Locus

Os01g0751600

Description

Class III lipase, Regulation of tillering, plant height, and spikelet fertility

RAP-DB Gene Symbol Synonym(s)

THIS1, This1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

THIS1

CGSNL Gene Name

HIGH TILLERING, REDUCED HEIGHT, AND INFERTILE SPIKELETS 1

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

"high-tillering, reduced height with infertile spikelet 1", "high tillering, reduced height, and infertile spikelets 1"

Transcript Evidence

AK108569

Protein Evidence

Q943F9

Literature

PMID: 24085578

Note

Manual Curation

December 19, 2016

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Functional domain (InterPro)

Alpha/Beta hydrolase fold (IPR029058)

Fungal lipase-like domain (IPR002921)

Full-length cDNA

002-145-D03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0751600-01)

RiceXPro (AK108569)

Others

Oryzabase (22376)

KEGG (Os01t0751600-01)

Transcript

1553 bp

>Os01t0751600-01 Class III lipase, Regulation of tillering, plant height, and spikelet fertility
ACGATTCGTCGCGTTCGCGTGCTGCCAAATCCTCCTCCCCCTCCTCCGTCCCCACAACAT
TCTGTCGCGCCGATTCGACCGTTGCCGCCTCGCCCGCTCCGCGCACGCGCGCACGCCGCT
CCCGTTCCCCTCGCGCACGCGCGGGCCATGGCGATCGACCTGGCGCCGCTGGCTGGGGAG
TTGGAGGTCGCGGGGGCGGCGGTTGGAGGGAAGAAAGAGGAGGGGGAGGGGGaggagggc
ggggtgtgcggcggggaggccgtggtggtggccgcggcggacgcggaggtgGAGGGCCAC
CCCTACGACTTCCACGTGTCCGGGCCGCGGAACCTGCCGCCGCCCAACTGGAGGGAGATC
ATCCGTTCGAGCTGGAAGGATCCCAATTACAAAAGGATGGTAATGGCCTGCTTCATTCAA
GCAGTCTACCTGCTTGAACTGGACAGGCAAGATGAGAAAGGAGAAGAGGATGGCCTTGCT
CCAAAATGGTGGAAGCCCTTCAAATACAAGGTCACACAGACATTGGTCGATGAGAGAGAT
GGTTCCATCTATGGTGCCGTCCTTGAGTGGGATCGTTCTTCTGCTTTGTCTGACCTTATC
CTCATAAGACCAAGTGGCGCGCCAAGGGCTGTGTTAGCTCTCCGAGGAACACTGCTTCAG
AAGCCCACCATCAAGAGAGACCTACAAGATGATCTTCGCTTCCTGGTGTGGGAGAGCTTA
AAAGGATCAGTCAGATATATTGGCGCTTTAGAAGCACTGAAGACAGCAGTTGAGAGGTTT
GGTAGCGCTAATGTCAGTGTTGCTGGGCACTCCTTGGGAGCTGGATTTGCTCTTCAGGTT
TGCAAAGAGCTCGCTAAGCAAGGAGTCTTCGTGGAGTGTCATCTGTTCAATCCACCTTCT
GTTTCACTTGCCATGGGTGTAAGGAGTATGAGTGAGAAGGCCAGCTACCTGTGGAAAAAA
GTTAAGGCTAGTCTACCACTGACTGAAGAAGCATTACCTGACAGTACCAAAGAGGAGGGA
AGTGCAAAGAAGAAATTGCGTGCTGACAAGAAATGGGTGCCACATTTATATGTAAACAAC
AGTGACTACATCTGCTGTCACTACAATGCCCCTAATTGCTCCACCACCACCACCACTACC
ACCACTGATGGTGCTTCAGATGAGCAGCAGCAGCAACGAAAGGCAAGTGAGATCGCTGGT
GATGTGGTCGCGAAGCTTTTTGTGACATCGAAAGGCCCACAGAAGTTTCTTGAAGCGCAT
GGGCTGGAGCAATGGTGGTCGGATGGCATGGAGCTGCAGCTAGCAGTGTATGACAGCAAG
CTTATATACAGGCAGTTGAAGTCCCTCTACACAGCAACTGCACCGTCACCCCCTGCAAAG
TAGTAGAAACTGCTGAGATCGCTGTTTCAACTGGCGTTAGAAATACTCTTTCTAATCAGT
TTCTGCCTCTATTAACTTGATATGTTTCATCATGGTTGTGACTGTGAACTATTATACAGT
AAAATATAATAAACGGACATGTGCTGATAAATACATTGATATTTTTCATGTTC

CDS

1236 bp

>Os01t0751600-01 Class III lipase, Regulation of tillering, plant height, and spikelet fertility
ATGGCGATCGACCTGGCGCCGCTGGCTGGGGAGTTGGAGGTCGCGGGGGCGGCGGTTGGA
GGGAAGAAAGAGGAGGGGGAGGGGGaggagggcggggtgtgcggcggggaggccgtggtg
gtggccgcggcggacgcggaggtgGAGGGCCACCCCTACGACTTCCACGTGTCCGGGCCG
CGGAACCTGCCGCCGCCCAACTGGAGGGAGATCATCCGTTCGAGCTGGAAGGATCCCAAT
TACAAAAGGATGGTAATGGCCTGCTTCATTCAAGCAGTCTACCTGCTTGAACTGGACAGG
CAAGATGAGAAAGGAGAAGAGGATGGCCTTGCTCCAAAATGGTGGAAGCCCTTCAAATAC
AAGGTCACACAGACATTGGTCGATGAGAGAGATGGTTCCATCTATGGTGCCGTCCTTGAG
TGGGATCGTTCTTCTGCTTTGTCTGACCTTATCCTCATAAGACCAAGTGGCGCGCCAAGG
GCTGTGTTAGCTCTCCGAGGAACACTGCTTCAGAAGCCCACCATCAAGAGAGACCTACAA
GATGATCTTCGCTTCCTGGTGTGGGAGAGCTTAAAAGGATCAGTCAGATATATTGGCGCT
TTAGAAGCACTGAAGACAGCAGTTGAGAGGTTTGGTAGCGCTAATGTCAGTGTTGCTGGG
CACTCCTTGGGAGCTGGATTTGCTCTTCAGGTTTGCAAAGAGCTCGCTAAGCAAGGAGTC
TTCGTGGAGTGTCATCTGTTCAATCCACCTTCTGTTTCACTTGCCATGGGTGTAAGGAGT
ATGAGTGAGAAGGCCAGCTACCTGTGGAAAAAAGTTAAGGCTAGTCTACCACTGACTGAA
GAAGCATTACCTGACAGTACCAAAGAGGAGGGAAGTGCAAAGAAGAAATTGCGTGCTGAC
AAGAAATGGGTGCCACATTTATATGTAAACAACAGTGACTACATCTGCTGTCACTACAAT
GCCCCTAATTGCTCCACCACCACCACCACTACCACCACTGATGGTGCTTCAGATGAGCAG
CAGCAGCAACGAAAGGCAAGTGAGATCGCTGGTGATGTGGTCGCGAAGCTTTTTGTGACA
TCGAAAGGCCCACAGAAGTTTCTTGAAGCGCATGGGCTGGAGCAATGGTGGTCGGATGGC
ATGGAGCTGCAGCTAGCAGTGTATGACAGCAAGCTTATATACAGGCAGTTGAAGTCCCTC
TACACAGCAACTGCACCGTCACCCCCTGCAAAGTAG

Protein

412 aa

>Os01t0751600-01 Class III lipase, Regulation of tillering, plant height, and spikelet fertility
MAIDLAPLAGELEVAGAAVGGKKEEGEGEEGGVCGGEAVVVAAADAEVEGHPYDFHVSGP
RNLPPPNWREIIRSSWKDPNYKRMVMACFIQAVYLLELDRQDEKGEEDGLAPKWWKPFKY
KVTQTLVDERDGSIYGAVLEWDRSSALSDLILIRPSGAPRAVLALRGTLLQKPTIKRDLQ
DDLRFLVWESLKGSVRYIGALEALKTAVERFGSANVSVAGHSLGAGFALQVCKELAKQGV
FVECHLFNPPSVSLAMGVRSMSEKASYLWKKVKASLPLTEEALPDSTKEEGSAKKKLRAD
KKWVPHLYVNNSDYICCHYNAPNCSTTTTTTTTDGASDEQQQQRKASEIAGDVVAKLFVT
SKGPQKFLEAHGLEQWWSDGMELQLAVYDSKLIYRQLKSLYTATAPSPPAK*

5'UTR

chr01:31526968..31527114 (- strand) : 147 bp

CDS

chr01:31526741..31526967 (- strand) : 227 bp

chr01:31524334..31525342 (- strand) : 1009 bp

3'UTR

chr01:31524164..31524333 (- strand) : 170 bp

FASTA

>Os01t0751600-01 class=Sequence position=chr01:31524164..31527114 (- strand)
ACGATTCGTC GCGTTCGCGT GCTGCCAAAT CCTCCTCCCC CTCCTCCGTC CCCACAACAT TCTGTCGCGC CGATTCGACC
GTTGCCGCCT CGCCCGCTCC GCGCACGCGC GCACGCCGCT CCCGTTCCCC TCGCGCACGC GCGGGCCATG GCGATCGACC
TGGCGCCGCT GGCTGGGGAG TTGGAGGTCG CGGGGGCGGC GGTTGGAGGG AAGAAAGAGG AGGGGGAGGG GGaggagggc
ggggtgtgcg gcggggaggc cgtggtggtg gccgcggcgg acgcggaggt gGAGGGCCAC CCCTACGACT TCCACGTGTC
CGGGCCGCGG AACCTGCCGC CGCCCAACTG GAGGGAGATC ATCCGTTCGA GCTGGTTGGT TTCCGGTTAC TCTCTCCATG
TTTCCTTGCG AAATCTTAGT TAATTAGTTT GATATATGCA TTTTGGCGTT ATGGAGATAT CAGATATGGT CGTCATGGGC
GTGAATCTGT GGGGATCGTT TACGCCGCGG GCACCCTTGG TTTGTTGCCT CTTCTGATTG ATCGGAAAAG GGACTATGTT
TTAGGGAGGG GATTGCCGTC CGGTTGCACC CGGCTCCCAG GATTGGAAGG GGAGGGAATA TGCTAGATGA AAGGCGATAG
CTTTGTTGGA TTGTAAACAA GGAACCGAAT TTACTGCTAT TTTCAGGATT TTGTTGCAAT CTGCACTGGC GCAAGGGTAT
AGCATGCATT AAGATTAAAA TCTCCAATCG ATCACCTCAC AAATGTCTGC ACAACATTTA AACTTTTTTT CAATGTCTTT
TCTGATGATC CTGCGATTCG GCGTGTCAGC TTTGTGTTTA GTTGGTTAGT GTTGCGCTTG CGCGCCTACA AGTAATAACC
TACAAGTCAG GTTACAGACT ACCATACCCA GAGTTTTGCC CTTCCTTCCA TACACTGTTT CGTGAGGCAT GGGTATGGAA
ATGCACCTAC CTTTTCTTAC GGATTGAGTA TTCTTCTTAA ACAAGAAAGT GAAGTAGCAG ATAATCAGTG ATTGAAACCA
AGGTCCTGTG GGTGGTACTT TCCTATGGGA TATGTATGGA CTTACTTTTG TTGAAGAGGT GCCTTTCTAA TTCTCGCCCC
TTGTTTTTAT GACCTTCAAT AATAATCAAT TATACAGTTC TACACTCTAT TGCTCTAGTT TTTAGGCTAT ACCATTTCAA
TTGGACGGTA CAAACTCTAC TGGTTGAACT AGAGTTATCA CTACAGTTCC CTTGCTTCGT GCTATAGTAC TTGGACGTAG
TCTCTAAAGC ATGGGCGGGA ATGGGTCACA GAATTGGTAT TCCGAAAAAG AAATATTCAC AGAATTGCAC GTTTCGTTCT
GAACATTATA AGTGCTTAGG ATGTCAGGTC TTAGTAAATT CCAATCTGTG GCAAGCATAC ACCAGTATTC CTATTAATAA
CGTAATTTCA TAAGCGGATG AAAGCTTTTC ACGACTTTTG GTGAAAATGG AACATGCAAA TCTGATAATT TTAGCGGACA
GGAGGTGCAT TACCATACCA AAAAAAAAAG AAATAATAAT AATATGAGCT ATTTGGTTTC TTTTGTCAAA GTTTGTCAGT
TAGTTATGAC ATCAAATATA TTTCGATTTG ACCTCATACA TACAAGAACT TCTGGTAATG CAGTATATGC TTTGTATGCG
TAACCAGGTT TACTTCAGTG TATCACACTT GTTAATTTGT ATCTGCTACC TTTAGTTCTA ATGCCATCAA TGTTGCTTTA
AATTGATTGC AGGAAGGATC CCAATTACAA AAGGATGGTA ATGGCCTGCT TCATTCAAGC AGTCTACCTG CTTGAACTGG
ACAGGCAAGA TGAGAAAGGA GAAGAGGATG GCCTTGCTCC AAAATGGTGG AAGCCCTTCA AATACAAGGT CACACAGACA
TTGGTCGATG AGAGAGATGG TTCCATCTAT GGTGCCGTCC TTGAGTGGGA TCGTTCTTCT GCTTTGTCTG ACCTTATCCT
CATAAGACCA AGTGGCGCGC CAAGGGCTGT GTTAGCTCTC CGAGGAACAC TGCTTCAGAA GCCCACCATC AAGAGAGACC
TACAAGATGA TCTTCGCTTC CTGGTGTGGG AGAGCTTAAA AGGATCAGTC AGATATATTG GCGCTTTAGA AGCACTGAAG
ACAGCAGTTG AGAGGTTTGG TAGCGCTAAT GTCAGTGTTG CTGGGCACTC CTTGGGAGCT GGATTTGCTC TTCAGGTTTG
CAAAGAGCTC GCTAAGCAAG GAGTCTTCGT GGAGTGTCAT CTGTTCAATC CACCTTCTGT TTCACTTGCC ATGGGTGTAA
GGAGTATGAG TGAGAAGGCC AGCTACCTGT GGAAAAAAGT TAAGGCTAGT CTACCACTGA CTGAAGAAGC ATTACCTGAC
AGTACCAAAG AGGAGGGAAG TGCAAAGAAG AAATTGCGTG CTGACAAGAA ATGGGTGCCA CATTTATATG TAAACAACAG
TGACTACATC TGCTGTCACT ACAATGCCCC TAATTGCTCC ACCACCACCA CCACTACCAC CACTGATGGT GCTTCAGATG
AGCAGCAGCA GCAACGAAAG GCAAGTGAGA TCGCTGGTGA TGTGGTCGCG AAGCTTTTTG TGACATCGAA AGGCCCACAG
AAGTTTCTTG AAGCGCATGG GCTGGAGCAA TGGTGGTCGG ATGGCATGGA GCTGCAGCTA GCAGTGTATG ACAGCAAGCT
TATATACAGG CAGTTGAAGT CCCTCTACAC AGCAACTGCA CCGTCACCCC CTGCAAAGTA GTAGAAACTG CTGAGATCGC
TGTTTCAACT GGCGTTAGAA ATACTCTTTC TAATCAGTTT CTGCCTCTAT TAACTTGATA TGTTTCATCA TGGTTGTGAC
TGTGAACTAT TATACAGTAA AATATAATAA ACGGACATGT GCTGATAAAT ACATTGATAT TTTTCATGTT C