Os01t0753500-01

Locus

Os01g0753500

Description

Transcriptional factor B3 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARF3

CGSNL Gene Name

AUXIN RESPONSE FACTOR 3

Oryzabase Gene Symbol Synonym(s)

OsARF3, ETT3, Os ETT3, OsETT3, DLN20, OsDLN20, ARF4

Oryzabase Gene Name Synonym(s)

auxin response factor-3, auxin response factor 3, OsETTIN3, ETTIN 3, DLN repressor 20, DLN motif protein 20

Transcript Evidence

AK072330 (DDBJ, Best hit)

Protein Evidence

Q5JMM1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Biological Process: response to hormone stimulus (GO:0009725)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcriptional factor B3 (IPR003340)

Auxin response factor (IPR010525)

DNA-binding pseudobarrel domain (IPR015300)

Full-length cDNA

J023039P13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0753500-01)

RiceXPro (AK072330)

Others

Oryzabase (10004)

KEGG (Os01t0753500-01)

Transcript

2942 bp

>Os01t0753500-01 Transcriptional factor B3 family protein.
CTCGCTGACTCGCTCCAGCCAGCAGCAGCAGCAGCAGCCACTGCTCGCGACGGAACAGAC
GACACCACCACGACGCCCGCGTCATAAAGGCATGGGCATTGTCGCAGGCTAGCCACAGCG
ACGGGGTAGCAGCAGCATCAGCAGCAGCAGCGGCAACAGCGACCGGCATTGATAGCGGCA
GCTGAGGAAGGAAGAGGGCGCGCGGTCGCCGCAGGAGCGGAGCAGGGGGGGCATGGGCTG
GGCGGGCTGAGCGCTGAGCAGGAGATGGCTGGAGAGCGACGCCCTCGGAGGCATTAATGG
CGTCGTCCGCATCCTCCTCCTCCTCCCCATCCTCGCGGCCGCCGCTGATGGCTCTCCCCT
CTTTTTACCGGCCCCCTTGGCCGTCCGAGAGGGGCGGCGAGCAGCGAGCCACCGACTGTT
GGGCCGGATCCCCAGCGGCGGGAGGCGGCCGGGCGCGTGCCACCGCCATGGGCATCGACC
TCAACAACACCGCGAGCGGCGGCGAGGAGGACGCGCCGGCGCCGGGGCCGGTGTGCCGGG
ATCTGTGGCACGCGTGCGCTGGGCCGGTGGTGTCGCTGCCGCGGCGGGGCAGCGCGGTCG
TGTACCTGCCGCAGGGGCACCTCTCCGCGGCCGGCGCCGGCGGCGGGATCCGCGGGGAGG
TGGCGGTTGCCCTCCCTCCCCACGTGGCGTGCCGCGTCGTGGACGTCGAGCTATGCGCGG
ATGCAGCGACGGACGAGGTGTACGCGCGACTGGCGCTGCGGGCGGAGGGCGAGGTATTTG
AGAGGAACTTGCATGGTGGTGGAATCGAAAGGGAGGATGACATGGAGGATGGTGATGAGG
AAAGGAAGTCCAGGATGCTGCACATGTTCTGCAAAACACTAACGGCCTCTGATACAAGCA
CACATGGAGGGTTCTCTGTTCCTCGTCGGGCTGCTGAGGATTGCTTTCCACCTCTGGACC
ACAAACAGCTAAGGCCTTCTCAAGAGCTTGTTGCCAAGGATTTGCATGGAGCAAAGTGGA
GGTTCCGCCATATTTATAGAGGTCAACCTCGCAGGCATCTTTTAACAACTGGATGGAGCT
CCTTTGTCAATAAAAAGAAACTGGTCTCAGGGGACGCGGTGTTATTTCTCCGGGGTGATG
ATGGTGAGCTAAGATTGGGTGTTCGAAGAGCTACTCAGCTTAAAAATGAAGCGATTTTCA
AAGCTTTTAGTAGCGAAAGTTCAAAGATGCGCACACTGTCGGCTGTGGCTGATTCCTTGA
AACATGGAAGTGTTTTTCACATTTGTTACAACCCAAGGGCTACTGCTTCTGAGTACGTTG
TTCCATATTGGAAGTTCGTGAAAAGCTTCAACCATCCAGTTTGTATTGGAATGAGGTTCA
AGTTTCATTTTGAGAGTGAAGATGTTAATGAGAGGCGTTCTGGAATGATTGCCGGTGTTA
GTGAAGTAGACCCCATCAGATGGCCTGGTTCAAAGTGGAGAAGCCTTCTGGTTCGATGGG
AGGATGCTACTGACTGCAACAGCCAAAATAGAGTATCTCCATGGGAGATTGAGATAGTTG
GTGGTTCAATCTCTGTTGCTCATTCTCTGTCGGCATCCAGTTCTAAAAGAACCAAATTAT
GCCCTCAGGGCAATTTGGACGTGCCAGCTCTGTATGGAAATGGTCGTCCAGACTCGGTGG
AAACTGAAAAGTTCCCCAGGGTCTTGCAAGGTCAAGAATTGATGGGTTCTAGGACCCATC
GTGCTACTTGTTCTCCTCAGTCAATCGACATTACAAAAAGTAAGTCTTTTGATGCTTGGA
GATTCCTTACTGATACACGAAGCTGCATGTTGGGCAGTTCAACAAGCAGACTTCCAGTGC
AGTACTCTGGCTATACCCACCAATCTGTAAGCTTCGGTGAATCTATTGGATTCCCAGAGG
TCTTGCAAGGTCAAGAAATTTCTCAGACAGTTCCTCCGTTTCAAGGAATGTTGCCTGATG
CATGTTCAGCGAAAAGCAGATATGAATTAAAGAATTATGTGTGCACCCCAGCTACCATGA
ATGGACTATCATCTGCAAATGAAGGATATTGTCTCTCCCTGTCAACTGTGCCACCTTCTC
CACCTTCCAGTCTTATGTTATACCAAACAGGGGTACCACAGCTTGAATTGGCAAGCAAGA
ACAATGACAAAAGTGGAAATGACAGCCAACCAGCCTTGCGACAGCACAAGTTGCTCAGTG
AAACTAGCTGGGACCAGTTTAAAATTGGAAAGGCTTCAACACCTGGGAATGCTACTAAGC
CTGGTAATGGTGGAAGGGAGGTTGACAGAACTAGTTGCCGCCTTTTTGGTTTTTCCTTGA
CCGAGAAGATTATCCCAACAGACAAAGATGGTGAAAAGGAAGTGAGTTATGAAACTGATT
GCCAAAATCCACGGATGCTAGACTTGTTTGGGTACAATTGCAGTACGCCTGGTGCTCTTC
ATGCCCTTTGTGCTGCTCCTTTGGGAATATGATGCTACTTGAGTAACTGGGAGGGATACG
TACATGTGGAGACGCAGCCACTCCACGCTTCATCCCAGATGTAAACGGCATCGGTCTGGT
TATGGTCCCACCGTTCCTGATGCTTTGCATGTAGGTATTGCTGCCTCACGCCTGAATACC
TACGTGCGGTCAGGCGAATAAAGCGACTCGATTGTATGTTTGACTGCAGCTCTAGCTGTC
GAGTCGGAAGGGCGATGATGTTTATCGTCGTTAATGTACCATCGGCACCCTGTTTATGCA
GAAATGTGGACCTAATTATTATGAACTTATTTCCTTAGTTCTATGTATGGTTAGCTTCTG
ATCTAGACCTAGTTATGAGCCTATTTCAGAAGTGCTATGTATGGTTTGCTTGTCAACATT
TGTTTCTGTATCGGTACAAATCACTATGTTTGTATGTTTATTATGCACTTCTTTTGTGTT
TT

CDS

2196 bp

>Os01t0753500-01 Transcriptional factor B3 family protein.
ATGGCGTCGTCCGCATCCTCCTCCTCCTCCCCATCCTCGCGGCCGCCGCTGATGGCTCTC
CCCTCTTTTTACCGGCCCCCTTGGCCGTCCGAGAGGGGCGGCGAGCAGCGAGCCACCGAC
TGTTGGGCCGGATCCCCAGCGGCGGGAGGCGGCCGGGCGCGTGCCACCGCCATGGGCATC
GACCTCAACAACACCGCGAGCGGCGGCGAGGAGGACGCGCCGGCGCCGGGGCCGGTGTGC
CGGGATCTGTGGCACGCGTGCGCTGGGCCGGTGGTGTCGCTGCCGCGGCGGGGCAGCGCG
GTCGTGTACCTGCCGCAGGGGCACCTCTCCGCGGCCGGCGCCGGCGGCGGGATCCGCGGG
GAGGTGGCGGTTGCCCTCCCTCCCCACGTGGCGTGCCGCGTCGTGGACGTCGAGCTATGC
GCGGATGCAGCGACGGACGAGGTGTACGCGCGACTGGCGCTGCGGGCGGAGGGCGAGGTA
TTTGAGAGGAACTTGCATGGTGGTGGAATCGAAAGGGAGGATGACATGGAGGATGGTGAT
GAGGAAAGGAAGTCCAGGATGCTGCACATGTTCTGCAAAACACTAACGGCCTCTGATACA
AGCACACATGGAGGGTTCTCTGTTCCTCGTCGGGCTGCTGAGGATTGCTTTCCACCTCTG
GACCACAAACAGCTAAGGCCTTCTCAAGAGCTTGTTGCCAAGGATTTGCATGGAGCAAAG
TGGAGGTTCCGCCATATTTATAGAGGTCAACCTCGCAGGCATCTTTTAACAACTGGATGG
AGCTCCTTTGTCAATAAAAAGAAACTGGTCTCAGGGGACGCGGTGTTATTTCTCCGGGGT
GATGATGGTGAGCTAAGATTGGGTGTTCGAAGAGCTACTCAGCTTAAAAATGAAGCGATT
TTCAAAGCTTTTAGTAGCGAAAGTTCAAAGATGCGCACACTGTCGGCTGTGGCTGATTCC
TTGAAACATGGAAGTGTTTTTCACATTTGTTACAACCCAAGGGCTACTGCTTCTGAGTAC
GTTGTTCCATATTGGAAGTTCGTGAAAAGCTTCAACCATCCAGTTTGTATTGGAATGAGG
TTCAAGTTTCATTTTGAGAGTGAAGATGTTAATGAGAGGCGTTCTGGAATGATTGCCGGT
GTTAGTGAAGTAGACCCCATCAGATGGCCTGGTTCAAAGTGGAGAAGCCTTCTGGTTCGA
TGGGAGGATGCTACTGACTGCAACAGCCAAAATAGAGTATCTCCATGGGAGATTGAGATA
GTTGGTGGTTCAATCTCTGTTGCTCATTCTCTGTCGGCATCCAGTTCTAAAAGAACCAAA
TTATGCCCTCAGGGCAATTTGGACGTGCCAGCTCTGTATGGAAATGGTCGTCCAGACTCG
GTGGAAACTGAAAAGTTCCCCAGGGTCTTGCAAGGTCAAGAATTGATGGGTTCTAGGACC
CATCGTGCTACTTGTTCTCCTCAGTCAATCGACATTACAAAAAGTAAGTCTTTTGATGCT
TGGAGATTCCTTACTGATACACGAAGCTGCATGTTGGGCAGTTCAACAAGCAGACTTCCA
GTGCAGTACTCTGGCTATACCCACCAATCTGTAAGCTTCGGTGAATCTATTGGATTCCCA
GAGGTCTTGCAAGGTCAAGAAATTTCTCAGACAGTTCCTCCGTTTCAAGGAATGTTGCCT
GATGCATGTTCAGCGAAAAGCAGATATGAATTAAAGAATTATGTGTGCACCCCAGCTACC
ATGAATGGACTATCATCTGCAAATGAAGGATATTGTCTCTCCCTGTCAACTGTGCCACCT
TCTCCACCTTCCAGTCTTATGTTATACCAAACAGGGGTACCACAGCTTGAATTGGCAAGC
AAGAACAATGACAAAAGTGGAAATGACAGCCAACCAGCCTTGCGACAGCACAAGTTGCTC
AGTGAAACTAGCTGGGACCAGTTTAAAATTGGAAAGGCTTCAACACCTGGGAATGCTACT
AAGCCTGGTAATGGTGGAAGGGAGGTTGACAGAACTAGTTGCCGCCTTTTTGGTTTTTCC
TTGACCGAGAAGATTATCCCAACAGACAAAGATGGTGAAAAGGAAGTGAGTTATGAAACT
GATTGCCAAAATCCACGGATGCTAGACTTGTTTGGGTACAATTGCAGTACGCCTGGTGCT
CTTCATGCCCTTTGTGCTGCTCCTTTGGGAATATGA

Protein

731 aa

>Os01t0753500-01 Transcriptional factor B3 family protein.
MASSASSSSSPSSRPPLMALPSFYRPPWPSERGGEQRATDCWAGSPAAGGGRARATAMGI
DLNNTASGGEEDAPAPGPVCRDLWHACAGPVVSLPRRGSAVVYLPQGHLSAAGAGGGIRG
EVAVALPPHVACRVVDVELCADAATDEVYARLALRAEGEVFERNLHGGGIEREDDMEDGD
EERKSRMLHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDHKQLRPSQELVAKDLHGAK
WRFRHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAVLFLRGDDGELRLGVRRATQLKNEAI
FKAFSSESSKMRTLSAVADSLKHGSVFHICYNPRATASEYVVPYWKFVKSFNHPVCIGMR
FKFHFESEDVNERRSGMIAGVSEVDPIRWPGSKWRSLLVRWEDATDCNSQNRVSPWEIEI
VGGSISVAHSLSASSSKRTKLCPQGNLDVPALYGNGRPDSVETEKFPRVLQGQELMGSRT
HRATCSPQSIDITKSKSFDAWRFLTDTRSCMLGSSTSRLPVQYSGYTHQSVSFGESIGFP
EVLQGQEISQTVPPFQGMLPDACSAKSRYELKNYVCTPATMNGLSSANEGYCLSLSTVPP
SPPSSLMLYQTGVPQLELASKNNDKSGNDSQPALRQHKLLSETSWDQFKIGKASTPGNAT
KPGNGGREVDRTSCRLFGFSLTEKIIPTDKDGEKEVSYETDCQNPRMLDLFGYNCSTPGA
LHALCAAPLGI*

5'UTR

chr01:31622910..31623205 (- strand) : 296 bp

CDS

chr01:31622490..31622909 (- strand) : 420 bp

chr01:31622347..31622403 (- strand) : 57 bp

chr01:31621755..31621937 (- strand) : 183 bp

chr01:31621566..31621650 (- strand) : 85 bp

chr01:31620842..31620932 (- strand) : 91 bp

chr01:31620594..31620758 (- strand) : 165 bp

chr01:31620357..31620473 (- strand) : 117 bp

chr01:31620205..31620280 (- strand) : 76 bp

chr01:31618672..31618834 (- strand) : 163 bp

chr01:31617747..31618585 (- strand) : 839 bp

3'UTR

chr01:31617730..31617746 (- strand) : 17 bp

chr01:31617190..31617622 (- strand) : 433 bp

FASTA

>Os01t0753500-01 class=Sequence position=chr01:31617190..31623205 (- strand)
CTCGCTGACT CGCTCCAGCC AGCAGCAGCA GCAGCAGCCA CTGCTCGCGA CGGAACAGAC GACACCACCA CGACGCCCGC
GTCATAAAGG CATGGGCATT GTCGCAGGCT AGCCACAGCG ACGGGGTAGC AGCAGCATCA GCAGCAGCAG CGGCAACAGC
GACCGGCATT GATAGCGGCA GCTGAGGAAG GAAGAGGGCG CGCGGTCGCC GCAGGAGCGG AGCAGGGGGG GCATGGGCTG
GGCGGGCTGA GCGCTGAGCA GGAGATGGCT GGAGAGCGAC GCCCTCGGAG GCATTAATGG CGTCGTCCGC ATCCTCCTCC
TCCTCCCCAT CCTCGCGGCC GCCGCTGATG GCTCTCCCCT CTTTTTACCG GCCCCCTTGG CCGTCCGAGA GGGGCGGCGA
GCAGCGAGCC ACCGACTGTT GGGCCGGATC CCCAGCGGCG GGAGGCGGCC GGGCGCGTGC CACCGCCATG GGCATCGACC
TCAACAACAC CGCGAGCGGC GGCGAGGAGG ACGCGCCGGC GCCGGGGCCG GTGTGCCGGG ATCTGTGGCA CGCGTGCGCT
GGGCCGGTGG TGTCGCTGCC GCGGCGGGGC AGCGCGGTCG TGTACCTGCC GCAGGGGCAC CTCTCCGCGG CCGGCGCCGG
CGGCGGGATC CGCGGGGAGG TGGCGGTTGC CCTCCCTCCC CACGTGGCGT GCCGCGTCGT GGACGTCGAG CTATGCGTGA
GTGAACCGCT GTCGCTCGTG GTAGGGTTTT CGCTGTGAGG CCGCGCGTGG TGGGCTGCAT TTACATGCTG GACTTTGTGC
AGGCGGATGC AGCGACGGAC GAGGTGTACG CGCGACTGGC GCTGCGGGCG GAGGGCGAGG TGCAACGCTG CTTCAATTAT
CTTATTGATT CATGTGCTTC CGGGATTGGG GATTGGATGA GATTCTTGGG GGCGTCAAAT GTTGGTTGCC TGCATCCTCT
TTTCAGCTTT GGGCGTGGCA TAAGCTGCAA TGTGATGGGT GTTGAATGAG CTTTGATTTT TATTGGATGT CTAAAAATAG
ACATTGTTGG TTCATTCTAA TTTTAGTGAG CCACATAATT TGGGACTTAC TAGATCTACT TGGCCAGCTT GATATAGTAT
GAGTGCCGTT TTCTCTGCAC AATGTAGCTT CATTTAGCAC ATCTATCATG CCTCTAATTT GTATATTGTA CCGATACGAT
GAATTGTTTT GGCATAACAA ATTCTATTAA CAGATTTGAT TTATCAATGG TACATTTGGT TGGTTCAGGT ATTTGAGAGG
AACTTGCATG GTGGTGGAAT CGAAAGGGAG GATGACATGG AGGATGGTGA TGAGGAAAGG AAGTCCAGGA TGCTGCACAT
GTTCTGCAAA ACACTAACGG CCTCTGATAC AAGCACACAT GGAGGGTTCT CTGTTCCTCG TCGGGCTGCT GAGGATTGCT
TTCCACCTCT GGTGATGAGA TTAGAAGTTT GATTTGTTTC CTATTGACTC TTCAAGTGAC TGCTTGTCTT GTGATGTAAC
TCTAACGAAG TTTGTTTTCT TTCGTGCCTT AATAGGACCA CAAACAGCTA AGGCCTTCTC AAGAGCTTGT TGCCAAGGAT
TTGCATGGAG CAAAGTGGAG GTTCCGCCAT ATTTATAGAG GTGACATCCG AGTACTTGAT AAGGGATATG CAATGCCCTT
GTTACACAAT CTATTTATTT AATTGCTAGT AAATGTTTGA TTTGATACCT TTGTATCGGA AACTTGTACG TCATACTCAT
GTTTGATGAT CGGGCATATA CAGAGCATTG CTAAATTATG TGTGACTGTT TTAGCTTTGA AAGAGGTCAG GAAGTATTTT
AGTCAATGCT ACAAAATATA TGGCAGGTGT AGCTTTTCAA CTCTTTGAAT GTTTGACATT CTAAGTGGTC AGTAGTTTTG
CCTGTCTGAA CTGCGCGTTC AGTCGTCTTT GCCATTCCCT AGGATGCAAA TTATTTCCTT CCTAGTTCAT CTTCTGATAC
AATTTATGTT ATTCTTTTGT GACTTCCATC ACTTTGTTAT ATATGGTGTG TTATCTCTGC AGTGAAAATT ACTTCTGTTA
ATAAAACTGT ACAATTTTGC TCAGATAGTA GTGTCCTTGA AACAGTGGAT AGAGGATGCT CTCCAATCTT ATTGTTGTCC
AAGCCAATAT CTCCATTTTG ATTACAAGGG AAATGCACAA GTTATCTTGT AGTTATAGCA TGTGATGGAG CAAAGTATGA
CATTATGAAT TTTTAACATT CTTTTCATTC CAGGTCAACC TCGCAGGCAT CTTTTAACAA CTGGATGGAG CTCCTTTGTC
AATAAAAAGA AACTGGTCTC AGGGGACGCG GTGTTATTTC TCCGGTAATC ACTTGATCCA GGTGTTAACC ATAAAGCTAA
TGCTTTCTTG TCTATATTTT CTAACGAAGC ATTTTAAGCG TTTGCAGGGG TGATGATGGT GAGCTAAGAT TGGGTGTTCG
AAGAGCTACT CAGCTTAAAA ATGAAGCGAT TTTCAAAGCT TTTAGTAGCG AAAGTTCAAA GATGCGCACA CTGTCGGCTG
TGGCTGATTC CTTGAAACAT GGAAGTGTTT TTCACATTTG TTACAACCCA AGGTCTGCTG AATAAAACAT ATAGTGTTTC
ATTTTGTGTG GTCCAACTCA ATACAATGTC ATTTTCTCTG GGGCAGTTGG ACTATATATC CATTCACATA TTGTAATCAT
TGGACTTTGT AGGGCTACTG CTTCTGAGTA CGTTGTTCCA TATTGGAAGT TCGTGAAAAG CTTCAACCAT CCAGTTTGTA
TTGGAATGAG GTTCAAGTTT CATTTTGAGA GTGAAGATGT TAATGAGAGG TTTGCATTTT TCAGTTGAAC TATCTTTTTT
TGTTTTTGCA TAATACTTTC TTGGGTCTTA CTATCTGTGT TGTAGGCGTT CTGGAATGAT TGCCGGTGTT AGTGAAGTAG
ACCCCATCAG ATGGCCTGGT TCAAAGTGGA GAAGCCTTCT GGTATGCATT TGAGCTGCTT TTTTATTAAG CTTGTTGACT
ACGGAACATT AACTTTTGGC TACCTGCCAA GTCTTTGAAA CATATATTAG GGCACCACAT ATAGTCAATT TCAGTTACTG
TTTTGTCTAT CGGATTAAAT GTGAGGTTAT TTCACACATT AAAATAAATT CATCAAGTTA GCTGAAGTGC TGAACTCTTG
AATATGGGTG CAACATCCTT CTTGTCAAAC TCAAATTTTG AATCCAAGCC TGATCTTGTG GAGTAGAGAA ATTACTTAGG
ATGTTCTATG ATCTTTTGTT TGTGAGTAAA TATGTGCAAA CATTAATAAA TGCTCAAGTG AGAACTGAGA AGTTGTCGAA
ATAAATTCAA TACGTAATAA AAATGGTGTG CTATAAAAAT GATTAGATGA TTTGTATCAC TTTGATTCCT ACATTTTGCA
GTCTCTTGCT TAGCCCACAT TAGTGGTTGG GACAAATCAT ATTAGTCAAT TGGGATGATA TATCAAGAAT AAAATGCCAA
CCCATCTAAA GGGAATCAGA ACAAATGGTC TTGTAAGTCC TTGAGGCACC TTAAGACAAA TGGTCCTCGC ATGCATTTCT
TTTTCACACT TCTGATCCCA AGATTCCCAT GTAGGTTTAC CATTAGCAGA TGTCAGATAG AGAATTGTTT CTGCTGGAGT
AAAATTTCTT AAGTATCTAG GCTTTTGTAG TTTGAGAACT TTGTAGTTCC TGCATTTCTA TTAATAGAAA TGGGGAGTTT
GGCCCCTTGA TAAAAAATAA GATAGAGAAT TGTTTCACGC ATATTTGGAT TGAAAAGGAC AATAATGATG TAGGATGTGT
ACAATCTGTT TATCCGTTTT GCTGTTTATA ACATCTGGTT GGCAGCTAAA AAAAACTCTC TTGATGAGGA ATTTCGTTGG
TCTTCTGCCA GTTGCCAATG TTTGTCGCCC TATGCCGCCC AATGAAGCTC ATTGAGCACA CAGGAGAAAC AAAACAGTGA
AGAGAATACT AGAGGCATGT TATTATTGCT TGCTAATATG GGCTGGAACT TGTTTGCTTT CATAATGTAA GCTGTAAGGA
TCATCAAAGT TGTGCAAAAC CAATTATTTA GAGGATTTAC TAACTGTAAC CATATACATT TTAATGCTAT CAACACCTTT
TATGATGGCA TCCATGTCTG TTTAGGTGGG GCTAAATATT TTTTATTGGA TTGGACCAAG ACCACATTAT CAAGGCCCCA
TAGGAAGCCT AACAGCTTAG AATTTTTATA GATTTTGATT TGTCCATTAT AAATCGTTTA TGGTGAATCT ATTGTCAATA
TTACCCAAAT TCGCTAATGT TAGCAATTTG ATTTGCTGTC TTTTCATACA GGTTCGATGG GAGGATGCTA CTGACTGCAA
CAGCCAAAAT AGAGTATCTC CATGGGAGAT TGAGATAGTT GGTGGTTCAA TCTCTGTTGC TCATTCTCTG TCGGCATCCA
GTTCTAAAAG AACCAAATTA TGCCCTCAGG GCAATTTGGA CGTGCCAGCT CTGTGTGAGT TCCAAGAGCA CGAGGTCAAT
ACTTGGATCT ATAAATTCTT TAACCCTATA TGCTTATTGG TTTTTGTGTT AATCCTGTAG ATGGAAATGG TCGTCCAGAC
TCGGTGGAAA CTGAAAAGTT CCCCAGGGTC TTGCAAGGTC AAGAATTGAT GGGTTCTAGG ACCCATCGTG CTACTTGTTC
TCCTCAGTCA ATCGACATTA CAAAAAGTAA GTCTTTTGAT GCTTGGAGAT TCCTTACTGA TACACGAAGC TGCATGTTGG
GCAGTTCAAC AAGCAGACTT CCAGTGCAGT ACTCTGGCTA TACCCACCAA TCTGTAAGCT TCGGTGAATC TATTGGATTC
CCAGAGGTCT TGCAAGGTCA AGAAATTTCT CAGACAGTTC CTCCGTTTCA AGGAATGTTG CCTGATGCAT GTTCAGCGAA
AAGCAGATAT GAATTAAAGA ATTATGTGTG CACCCCAGCT ACCATGAATG GACTATCATC TGCAAATGAA GGATATTGTC
TCTCCCTGTC AACTGTGCCA CCTTCTCCAC CTTCCAGTCT TATGTTATAC CAAACAGGGG TACCACAGCT TGAATTGGCA
AGCAAGAACA ATGACAAAAG TGGAAATGAC AGCCAACCAG CCTTGCGACA GCACAAGTTG CTCAGTGAAA CTAGCTGGGA
CCAGTTTAAA ATTGGAAAGG CTTCAACACC TGGGAATGCT ACTAAGCCTG GTAATGGTGG AAGGGAGGTT GACAGAACTA
GTTGCCGCCT TTTTGGTTTT TCCTTGACCG AGAAGATTAT CCCAACAGAC AAAGATGGTG AAAAGGAAGT GAGTTATGAA
ACTGATTGCC AAAATCCACG GATGCTAGAC TTGTTTGGGT ACAATTGCAG TACGCCTGGT GCTCTTCATG CCCTTTGTGC
TGCTCCTTTG GGAATATGAT GCTACTTGAG TAACTGGTAT GCTCTAGTTC TTCCTTACTG CTGAAAATTC ACTTCTCCTG
TACCTTTGGA CCTCGTACTC TACCATTATC CAAAAGCTAA TTTGGTCACT GACATTTACA CAGGGAGGGA TACGTACATG
TGGAGACGCA GCCACTCCAC GCTTCATCCC AGATGTAAAC GGCATCGGTC TGGTTATGGT CCCACCGTTC CTGATGCTTT
GCATGTAGGT ATTGCTGCCT CACGCCTGAA TACCTACGTG CGGTCAGGCG AATAAAGCGA CTCGATTGTA TGTTTGACTG
CAGCTCTAGC TGTCGAGTCG GAAGGGCGAT GATGTTTATC GTCGTTAATG TACCATCGGC ACCCTGTTTA TGCAGAAATG
TGGACCTAAT TATTATGAAC TTATTTCCTT AGTTCTATGT ATGGTTAGCT TCTGATCTAG ACCTAGTTAT GAGCCTATTT
CAGAAGTGCT ATGTATGGTT TGCTTGTCAA CATTTGTTTC TGTATCGGTA CAAATCACTA TGTTTGTATG TTTATTATGC
ACTTCTTTTG TGTTTT

Locus: Os01g0753500

Loading...

Locus: Os01g0753500

Loading...