Os01t0757600-00

Locus

Os01g0757600

Description

Similar to Myosin heavy chain-like protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

Q84VF1 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Expression Databases

TENOR (Os01t0757600-00)

Transcript

840 bp

>Os01t0757600-00 Similar to Myosin heavy chain-like protein (Fragment).
ATGCCGAGATCCAGGGGGTCCGAGCTGCCGCAGCGAGCGTCGCCGCGGGCGCCGCTGCAC
CTCAAGACGACGGCCTGCTCGGATGCGAATGGCGCGCACCACCGTACAGTCGTCGACCGG
AGCAGCCCCAAGCTCGCCGACCGCCACTCGCCGCGCAGCCCGCTGCATGAGAAGAAGCGC
GCGGGGACGCGGGTGGCTgagctggagacgaagctgggcaaggtgcaggacgagctcaag
aagctgcgggagcagctcgccaccgccgaggccgccaagaaggacgcGCAGGTCGCGCTC
GAGGAGGCTAAGAAGCGCGTTGGCACCAAGGGGAGCCCCGCTTCCGCCGCCGCGGCGTCT
CCGCGCTCCCCATCTCCGGTTGCGGTCGAAACCCCCAAGAAGACTGAGCAGCAGCTGAAG
GTGACGGAGCCGCCGGCCGAGGAGGAGAGCAGCATAAACTCCCCCGCGACGGATGTGTTC
GAGGTCGTCCGGACCGAATCGGGGGATAAGGAGAACCAGAGCGCGGCCGGCGCCGAGGAC
GGCGAGGAGGTGAGCTGTGGCATAAAGGCCGCTTTGGCTGAGAAGGAACTGGAGGAGGAA
GAGACAAAGAAGATGATCGAAGAGGAGAGCATTGACGCAACGGCCATTGACTCCGGCGAG
AAGGAGAACCCGGAGGTCGCGGAACTAAAGGCCAAGCTGATGGCGAAGGACATGGAGGTC
GCCATACTCACGGCCGACAATGCCGAGCTCAAGAAGCAGGTTGGTGAAGCCGCGGAGGCG
GCCAAGAAAGCTGAGGAGGAGGCGGCGGCGGCGGCGAGCCCCCGAGAGGCCCAGATCTAG

CDS

840 bp

>Os01t0757600-00 Similar to Myosin heavy chain-like protein (Fragment).
ATGCCGAGATCCAGGGGGTCCGAGCTGCCGCAGCGAGCGTCGCCGCGGGCGCCGCTGCAC
CTCAAGACGACGGCCTGCTCGGATGCGAATGGCGCGCACCACCGTACAGTCGTCGACCGG
AGCAGCCCCAAGCTCGCCGACCGCCACTCGCCGCGCAGCCCGCTGCATGAGAAGAAGCGC
GCGGGGACGCGGGTGGCTgagctggagacgaagctgggcaaggtgcaggacgagctcaag
aagctgcgggagcagctcgccaccgccgaggccgccaagaaggacgcGCAGGTCGCGCTC
GAGGAGGCTAAGAAGCGCGTTGGCACCAAGGGGAGCCCCGCTTCCGCCGCCGCGGCGTCT
CCGCGCTCCCCATCTCCGGTTGCGGTCGAAACCCCCAAGAAGACTGAGCAGCAGCTGAAG
GTGACGGAGCCGCCGGCCGAGGAGGAGAGCAGCATAAACTCCCCCGCGACGGATGTGTTC
GAGGTCGTCCGGACCGAATCGGGGGATAAGGAGAACCAGAGCGCGGCCGGCGCCGAGGAC
GGCGAGGAGGTGAGCTGTGGCATAAAGGCCGCTTTGGCTGAGAAGGAACTGGAGGAGGAA
GAGACAAAGAAGATGATCGAAGAGGAGAGCATTGACGCAACGGCCATTGACTCCGGCGAG
AAGGAGAACCCGGAGGTCGCGGAACTAAAGGCCAAGCTGATGGCGAAGGACATGGAGGTC
GCCATACTCACGGCCGACAATGCCGAGCTCAAGAAGCAGGTTGGTGAAGCCGCGGAGGCG
GCCAAGAAAGCTGAGGAGGAGGCGGCGGCGGCGGCGAGCCCCCGAGAGGCCCAGATCTAG

Protein

280 aa

>Os01t0757600-00 Similar to Myosin heavy chain-like protein (Fragment).
MPRSRGSELPQRASPRAPLHLKTTACSDANGAHHRTVVDRSSPKLADRHSPRSPLHEKKR
AGTRVAELETKLGKVQDELKKLREQLATAEAAKKDAQVALEEAKKRVGTKGSPASAAAAS
PRSPSPVAVETPKKTEQQLKVTEPPAEEESSINSPATDVFEVVRTESGDKENQSAAGAED
GEEVSCGIKAALAEKELEEEETKKMIEEESIDATAIDSGEKENPEVAELKAKLMAKDMEV
AILTADNAELKKQVGEAAEAAKKAEEEAAAAASPREAQI*

CDS

chr01:31816519..31816532 (- strand) : 14 bp

chr01:31816289..31816445 (- strand) : 157 bp

chr01:31815517..31816185 (- strand) : 669 bp

FASTA

>Os01t0757600-00 class=Sequence position=chr01:31815517..31816532 (- strand)
ATGCCGAGAT CCAGGTGCGT GACCTGCGAT AGCGAGGTGG TTTCCCCGTC GAGGTGTTCC CATTTCTGAC GCGGTTGATG
ATTGCAGGGG GTCCGAGCTG CCGCAGCGAG CGTCGCCGCG GGCGCCGCTG CACCTCAAGA CGACGGCCTG CTCGGATGCG
AATGGCGCGC ACCACCGTAC AGTCGTCGAC CGGAGCAGCC CCAAGCTCGC CGACCGCCAC TCGCCGCGCA GCCCGCTGCA
TGAGGTAAGT AATAAGCTGC GAAGCTTCTC CTTCCGTTTT CAGTTTTCCC GGTGAGGCCA AGGAGCAGCG GCTCAATCGC
TTTTGGCGGT TATTGGTGGG TTTACAGAAG AAGCGCGCGG GGACGCGGGT GGCTgagctg gagacgaagc tgggcaaggt
gcaggacgag ctcaagaagc tgcgggagca gctcgccacc gccgaggccg ccaagaagga cgcGCAGGTC GCGCTCGAGG
AGGCTAAGAA GCGCGTTGGC ACCAAGGGGA GCCCCGCTTC CGCCGCCGCG GCGTCTCCGC GCTCCCCATC TCCGGTTGCG
GTCGAAACCC CCAAGAAGAC TGAGCAGCAG CTGAAGGTGA CGGAGCCGCC GGCCGAGGAG GAGAGCAGCA TAAACTCCCC
CGCGACGGAT GTGTTCGAGG TCGTCCGGAC CGAATCGGGG GATAAGGAGA ACCAGAGCGC GGCCGGCGCC GAGGACGGCG
AGGAGGTGAG CTGTGGCATA AAGGCCGCTT TGGCTGAGAA GGAACTGGAG GAGGAAGAGA CAAAGAAGAT GATCGAAGAG
GAGAGCATTG ACGCAACGGC CATTGACTCC GGCGAGAAGG AGAACCCGGA GGTCGCGGAA CTAAAGGCCA AGCTGATGGC
GAAGGACATG GAGGTCGCCA TACTCACGGC CGACAATGCC GAGCTCAAGA AGCAGGTTGG TGAAGCCGCG GAGGCGGCCA
AGAAAGCTGA GGAGGAGGCG GCGGCGGCGG CGAGCCCCCG AGAGGCCCAG ATCTAG