Os01t0758400-02

Locus

Os01g0758400

Description

Similar to Phosphatidate cytidylyltransferase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK059301 (DDBJ, Best hit)

Protein Evidence

B8A9S4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: phosphatidate cytidylyltransferase activity (GO:0004605)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Phosphatidate cytidylyltransferase (IPR000374)

Phosphatidate cytidylyltransferase, eukaryota (IPR016720)

Full-length cDNA

001-025-F05 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0758400-02)

Transcript

1828 bp

>Os01t0758400-02 Similar to Phosphatidate cytidylyltransferase.
CCTCTCCCTCTCTAGTCTCTCTCTCCTCCCCCTTCTCGAAGCACGCTGCCGCCGCCTCCT
CTCCCCGCGCCGCGCGCCTCGCCGAGTTAGGGTTCCGGCGAGCTCGGGGCCTTTCTCCGG
CGACGGCGCCCTCCTCCGGCCCGAGGGCTCGCTTCGCGGTGAGATCAAATAGCAGCGATG
GAAAGGGACACAAGCTCTAGTGATGTTTCTGCTTCTCATGTAGGACGTGCCAGGCAGCGA
AGACGTCCTACTGAGGCTACTGCAGATGGGAATAGAACCAATGGACCAGCTTTGCTTGTC
AATGATCAGAATAAGTACAAGTCAATGCTTATCCGTACATATTCTACAGTATGGATGATT
GGAGGCTTTGTGTTGATAGTTTATATGGGTCACCTCTATATCTGGGCCATGGTGGTTGTT
ATTCAAATATTCATGGCCAAAGAGCTTTTTAACCTACTCAGAAAATCCAGTGAAGAAAAA
CAACTACCAGGTTTCAGGCTACTGAATTGGCACTTCTTTTTCACAGCAATGTTGTTTACT
TATGGGCGTTTTCTTAGTCGACAGCTTGTTAACACAGTAACTTCAGATCACTTATTGTAT
AAGGTTGTCAGTGGTCTCATAAAGTATCAGATGTTCATTTGCTATTTTCTTTACATTGCT
GGATTTGTCTGGTTTATTTTGACTCTGAAGAAAAAGACATACAAGTATCAGTTCAAACAA
TATGCCTGGACGCACATGATCCTTTTAACGGTTTTTGCACAATCTTCTTTTACCGTGGCA
AATATATTTGAAGGGATGTTCTGGTTTCTGTTGCCTGCTTCTCTCATTGTGATTAACGAC
ATTGCTGCCTATCTATTTGGGTTCTTTCTTGGGAGAACACCTCTGATCAAGTTATCTCCA
AAGAAAACTTGGGAAGGTTTTATTGGTGCATCTGTGACAACTATCATATCTGCTTTTGTG
TTAGCAAATGTAATGGGCCGTTTCCAATGGTTGACATGCCCAAGAAAAGACCTGTCGACA
GGGTGGCTTCGTTGTGACCCTGGTCCTATGTTTAAGCCAGAACATTATTCTTTGGGAGAA
TGGGTGCCAAAGGGGTTCCCTTGGAAGGAAGTTGTTCTTTTGCCTGTGCAGTGGCATGCT
TTAGCACTAGGTTTGTTTGCATCAATAATAGCACCTTTTGGAGGTTTCTTTGCAAGTGGC
TTCAAGAGGGCCTTTAAAATAAAGGATTTTGGAGACAGCATACCTGGGCATGGTGGGATT
ACTGACCGAATGGATTGTCAGATGGTTATGGCAGTTTTTGCATACATATATCACCAATCA
TTCATATCGCCCCAAAACTACTCTGTTGAGCTAATCTTGGAACAGATTCTAAGAAATCTA
ACCTTTGAGGAGCAGAAATTCTTATATCAGCAGCTTGGGGAAATCTACCGTGAAAGGCAA
TTAATGCAGAGCTGAGAACTAGTTTGCTTATGATGAAGCATACAGTATGTTGTTTTTGAG
CGCTCGGTTCCATGTATAGCAGCATAGCTTCTCTGTACGGCGATAGAGCAACGTCCCTTT
CCAAACCATTGTACAGAATAGAGTGTGGATGGGGTTTAGCGATTTAGGTACTTGATTCGC
TCTCCACTTACGTTGCCTTCTCTGGCGATCGGTTTATCCTTTTACGCTAATTCTCATCAT
TTCTGCCCTTGTAACAAGGGAACCGGAAAAGGTTGTATTCGTGTATATCACTTCGTGTGT
TGGCCTCACATCAAATATGTGCAAGATGCACAAGATAACACAGGAAATGAGGAAAATTTA
TTCCCCTTTTAAAAGATATTTTCGTGGT

CDS

1293 bp

>Os01t0758400-02 Similar to Phosphatidate cytidylyltransferase.
GATCAAATAGCAGCGATGGAAAGGGACACAAGCTCTAGTGATGTTTCTGCTTCTCATGTA
GGACGTGCCAGGCAGCGAAGACGTCCTACTGAGGCTACTGCAGATGGGAATAGAACCAAT
GGACCAGCTTTGCTTGTCAATGATCAGAATAAGTACAAGTCAATGCTTATCCGTACATAT
TCTACAGTATGGATGATTGGAGGCTTTGTGTTGATAGTTTATATGGGTCACCTCTATATC
TGGGCCATGGTGGTTGTTATTCAAATATTCATGGCCAAAGAGCTTTTTAACCTACTCAGA
AAATCCAGTGAAGAAAAACAACTACCAGGTTTCAGGCTACTGAATTGGCACTTCTTTTTC
ACAGCAATGTTGTTTACTTATGGGCGTTTTCTTAGTCGACAGCTTGTTAACACAGTAACT
TCAGATCACTTATTGTATAAGGTTGTCAGTGGTCTCATAAAGTATCAGATGTTCATTTGC
TATTTTCTTTACATTGCTGGATTTGTCTGGTTTATTTTGACTCTGAAGAAAAAGACATAC
AAGTATCAGTTCAAACAATATGCCTGGACGCACATGATCCTTTTAACGGTTTTTGCACAA
TCTTCTTTTACCGTGGCAAATATATTTGAAGGGATGTTCTGGTTTCTGTTGCCTGCTTCT
CTCATTGTGATTAACGACATTGCTGCCTATCTATTTGGGTTCTTTCTTGGGAGAACACCT
CTGATCAAGTTATCTCCAAAGAAAACTTGGGAAGGTTTTATTGGTGCATCTGTGACAACT
ATCATATCTGCTTTTGTGTTAGCAAATGTAATGGGCCGTTTCCAATGGTTGACATGCCCA
AGAAAAGACCTGTCGACAGGGTGGCTTCGTTGTGACCCTGGTCCTATGTTTAAGCCAGAA
CATTATTCTTTGGGAGAATGGGTGCCAAAGGGGTTCCCTTGGAAGGAAGTTGTTCTTTTG
CCTGTGCAGTGGCATGCTTTAGCACTAGGTTTGTTTGCATCAATAATAGCACCTTTTGGA
GGTTTCTTTGCAAGTGGCTTCAAGAGGGCCTTTAAAATAAAGGATTTTGGAGACAGCATA
CCTGGGCATGGTGGGATTACTGACCGAATGGATTGTCAGATGGTTATGGCAGTTTTTGCA
TACATATATCACCAATCATTCATATCGCCCCAAAACTACTCTGTTGAGCTAATCTTGGAA
CAGATTCTAAGAAATCTAACCTTTGAGGAGCAGAAATTCTTATATCAGCAGCTTGGGGAA
ATCTACCGTGAAAGGCAATTAATGCAGAGCTGA

Protein

431 aa

>Os01t0758400-02 Similar to Phosphatidate cytidylyltransferase.
DQIAAMERDTSSSDVSASHVGRARQRRRPTEATADGNRTNGPALLVNDQNKYKSMLIRTY
STVWMIGGFVLIVYMGHLYIWAMVVVIQIFMAKELFNLLRKSSEEKQLPGFRLLNWHFFF
TAMLFTYGRFLSRQLVNTVTSDHLLYKVVSGLIKYQMFICYFLYIAGFVWFILTLKKKTY
KYQFKQYAWTHMILLTVFAQSSFTVANIFEGMFWFLLPASLIVINDIAAYLFGFFLGRTP
LIKLSPKKTWEGFIGASVTTIISAFVLANVMGRFQWLTCPRKDLSTGWLRCDPGPMFKPE
HYSLGEWVPKGFPWKEVVLLPVQWHALALGLFASIIAPFGGFFASGFKRAFKIKDFGDSI
PGHGGITDRMDCQMVMAVFAYIYHQSFISPQNYSVELILEQILRNLTFEEQKFLYQQLGE
IYRERQLMQS*

5'UTR

chr01:31877378..31877539 (- strand) : 162 bp

CDS

chr01:31877377..31877377 (- strand) : 1 bp

chr01:31876561..31876652 (- strand) : 92 bp

chr01:31875860..31876113 (- strand) : 254 bp

chr01:31875577..31875728 (- strand) : 152 bp

chr01:31874742..31874883 (- strand) : 142 bp

chr01:31873892..31874048 (- strand) : 157 bp

chr01:31873628..31873675 (- strand) : 48 bp

chr01:31873446..31873532 (- strand) : 87 bp

chr01:31872442..31872570 (- strand) : 129 bp

chr01:31872289..31872345 (- strand) : 57 bp

chr01:31871475..31871558 (- strand) : 84 bp

chr01:31871306..31871395 (- strand) : 90 bp

3'UTR

chr01:31870933..31871305 (- strand) : 373 bp

FASTA

>Os01t0758400-02 class=Sequence position=chr01:31870933..31877539 (- strand)
CCTCTCCCTC TCTAGTCTCT CTCTCCTCCC CCTTCTCGAA GCACGCTGCC GCCGCCTCCT CTCCCCGCGC CGCGCGCCTC
GCCGAGTTAG GGTTCCGGCG AGCTCGGGGC CTTTCTCCGG CGACGGCGCC CTCCTCCGGC CCGAGGGCTC GCTTCGCGGT
GAGGTCTCAA TCTCACCCGC TCGTCCCTTT CGCTTACTTT GCTGGTTGCT GGTTGGATTG CAAGCAGTTC CGTGCTAGTT
TTAGGGGTGG GCTTGTTTGA TGTTTGTGTT GTTGAGGGAT TCGTTATCAG GTGTTCGTGC GTGACTCTGG GGTTGTGATT
GATGCGGCAC AGTGGGCTAG TGATTGCTTT TCGTTTTAAA AACGAATTCC GGGGGGAATA TTACGCCCTG GCTTTTTAGC
TGGCCATGGA ATGCTGCTGT TGCGAATGAT TTTTAGTTGG TTAGCTGGAG GTATTCTCTC GAACCAAATT GTTATTAAGA
GAGATGAGTT GGGGAACGGC CTGCAGATGA GCGGCTGCGA GCAGGAATCA ATAATCGTGA CAGCGATGTG TTTAGTTTAT
TGCGTGGACG TTGGATATTC AGTGTTGTAG GTGTGGGGCA AAGGGGGGCG CTTGCCGTGC CACAGCAAGG AAGTTTGCAT
GGTTGGCTTC TTGTCATCTA ATCATTTCAC ACGCACGAAC TGCTAGTTTG CCGAGTTACT TGTTATTATG GCAGTTTAGT
GTTAGAGCGA GCTTTGTACT GTGATCTCCA ATTGTTGCAC ATTCTACTTA TCAGAACCAT CTCTAAATTG TAAAGTTCTG
TTTACTGTGT ATTCTATGAG TTACTCGCTA TAGTCAGTAT GTGTTCTTAT TGAATCCGGT CTGATTGACT ACTATGATTT
TATATAGATC AAATAGCAGC GATGGAAAGG GACACAAGCT CTAGTGATGT TTCTGCTTCT CATGTAGGAC GTGCCAGGCA
GCGAAGACGT CCTACTGAGG TAGGCTATTT CATTATGACA AATTTTAGCA AACAGAAAGG CCCCTTGGTT TCTCAGTATG
CATTGCCTTC ATATCTCCGT GTTTATTTAT TTTTGTGGTT GGGCAGACCC TTGTGGTTGG GAAGAGTGGT TCATTTATTT
TGTTTGTATA GTGAGCTTGC TGTGCTATTG TGTAACCAAA ATGCCTATCT TTTAACTTTA CTTTCTCAAT TATTTTGGAC
TTCTCATAAC CATACCTGTA GGGTGAGTTG TTGATGTGAA TAAAAATTGT TTGCTCTGTT GTTACTACAT TTATTTACTC
TTCCATCTCT TCATTCTTCC TTTTTATTAT TTTTTGAGTT TTCCGAGTCA CTGAAACAGG AGCACGATGC AAAGCTAAAG
CAACAACTTG TTTTGTGTTA CACCTGGCAC ACATTTTTTG GAGCTTATTG ATACCTTTTT GTTCAGGCTA CTGCAGATGG
GAATAGAACC AATGGACCAG CTTTGCTTGT CAATGATCAG AATAAGTACA AGTCAATGCT TATCCGTACA TATTCTACAG
TATGGATGAT TGGAGGCTTT GTGTTGATAG TTTATATGGG TCACCTCTAT ATCTGGGCCA TGGTGGTTGT TATTCAAATA
TTCATGGCCA AAGAGCTTTT TAACCTACTC AGAAAATCCA GTGAAGAAAA ACAACTACCA GGTTTCAGGC TACTGAATTG
GTAGGTCATT TCAATTGTAC TATGATTTGA GCTGGAATTT TTTTTAATCT CGTAGATGCC ATCAATGCAA TGCTTTTCAA
AAGTATGCCT ATTCTGTTCA AGTTCTTTAT GTAAGGGTTT TTTTTTTGCA GGCACTTCTT TTTCACAGCA ATGTTGTTTA
CTTATGGGCG TTTTCTTAGT CGACAGCTTG TTAACACAGT AACTTCAGAT CACTTATTGT ATAAGGTTGT CAGTGGTCTC
ATAAAGTATC AGATGTTCAT TTGCTATTTT CTTTACATTG CTGGTAAGTA CAGTGTGCAA TTAATTTGAA ACAATAACTA
TTCATTAAGA ATTTCATTGT GTTTAAAAAG ACTCAAGAAT AGTTATGTGT TTCTTACATG ATCATAGCTT TAAAGAGCTT
GTCCAAACTA ACTACATTGT ACCCATATCA TCTATGGCCC CCTGCGCTGC TAAAGAATCC CACAGCCAAC TTCCGCAGTC
ATTATTTAGT TTTTCATGAT TTCAGTTGTC TTGAGTGGTA TCATTTCATC TATAGCACTG GCATTAAAAC ACCAACTGAA
TATTATCTAG AGAACAGTTT CTGCATTCAT TATTTAGTTT TCATCTTTTT AGTTGTCTTG AGTATAGTTT TAGCTCTGGC
ATTAAAACAA GTATTCATGC GAACTTCTTG GTTCCTCTTT GTTTTATTGA TTTGAACCGG TTGGCAGAGA ATCCACTTCA
TTTCAATTGT TTTGGACTTG GCATCATCCC ATGAGCCCTT TTCAAATGTT CAGAGCTCAG TGCTTGTATA ACATTGCAGA
CCTGCCTAAG TGTTCAAAAA GGATCTAATG TGCACATGCT TGTTTCTTTG ACAATTTTTT CCATTCACTC GATTGGATTA
GTTATGCTAT ATACAGTCCT ACTTTGGTAA TCTGTCATCT TGGCGATATC TAGTTCTTGT CTGGCAAAAA GTATAATGTA
AACTGCCATG ATCCAGGATT TGTCTGGTTT ATTTTGACTC TGAAGAAAAA GACATACAAG TATCAGTTCA AACAATATGC
CTGGACGCAC ATGATCCTTT TAACGGTTTT TGCACAATCT TCTTTTACCG TGGCAAATAT ATTTGAAGGG ATGTTCTGGT
AAGCCATATA TTTCCTTGCT AACACCTCCG TGTTAAAAAA AAATTAGATG CATGATTTCT TGTAGCAATT TTAATTTAAT
AGTGACTCTA ACATGTTTTT TATTAGGTAA TTAATCATTC AGAAGTTTCC TCATGTATAG AAGTTAAACA AAAAACACCA
CAAAAATTTT CTGAGACTCT AAATCTTCTG TGCTCTATGC TTAACTTTGC AGAATTCTAC AGTAGTAACA TCATGCTGCC
CAACTTGTCT GGCAGCTGCA AAAAACAATT TACCCTGATC CTCTTCAACT TAAAAGGAAT ATTAACTGTA ACAATGATAT
AGTCACTGGG CCAGCCATAT TTGACCTATT TATATATCTG TTTGCACCAT GGACCTACCA ATTTTGGGAT GCTCAGTACT
CCATCAGGGA AAAAGCAGAA AATCTTAGGA GCACCATTTG CAAAAATGAA ACAGTCATAC ACAGTATGTT TGTGCCTTGC
TATTTCCTTT TTGCACCGTA CCAATTATGA GCAGGTAGAG TTCTTTTTTT GGGTCGAACT ATCGAATGTC ATCCACACAT
CAGTAAATGA TGTACTGTAG ATTGTAGAGA ACTTGTCATA TTATGTGCAT GCTATTTATC TAGAAACAGA TTACATTATA
GACACCATTT GACAAACTCC ATATAATTCC TTTGTAATGC TACTTACACA GGTTTCTGTT GCCTGCTTCT CTCATTGTGA
TTAACGACAT TGCTGCCTAT CTATTTGGGT TCTTTCTTGG GAGAACACCT CTGATCAAGT TATCTCCAAA GAAAACTTGG
GAAGGTTTTA TTGGTGCATC TGTGACAACT ATCATATCTG CTTTTGTGGT GAGATGAAAG CTTCTGTTAA TTGTTTTTGT
AGTTCTCTAA CTATGCTAGT CTATGTCAGT TAGCATGGTT TATTTTCACG CAAGACTACT ATGCCACTTC AAGGGGTAGC
TTTAAATAAT AATTCATTTC AGTTTTTCAT GCAAAAGATG ATATCTGGAC ATTATATTTC TAGTTATATT TGACACTGTT
TTTCACTCCC TTTTTTTTTG GCAGTTAGCA AATGTAATGG GCCGTTTCCA ATGGTTGACA TGCCCAAGAA AAGTGAGATA
TCATTTCCTT TGGAATGTGA TTGTGAGTTG TCTACACAAT TTGCTACTGT GATTCTTTTC TTATATTTAT CACGCAAATG
ATTTCAGGAC CTGTCGACAG GGTGGCTTCG TTGTGACCCT GGTCCTATGT TTAAGCCAGA ACATTATTCT TTGGGAGAAT
GGGTGCCAAA GGGGGTAAGA ACATTGAACA TTATTCTGTT CAATTTATTT ATTTTACTTT CGCTGTTATA GGTTGTTTAC
GTTACCCCTC TAGGTTAAGT TCCTAAGGTA AAGCCTAACC ATGAATATTA TCAATGTGGC CAAGGAAAGT TTTCAGTTCT
CATACCCATT ATCATACTGA TTTTTTTTTT GGGTTATAGA CTGGAAAACT TGGGAACATG GAATTGAGTT AGTTGATTTG
TTTATAATTC CGTTGAAATC ACAAGAGGAG CAAAGTTCCT TGTTCCAAGT CAAGATGCTG CGTCCTGTTA TACTTGAAAA
AGCACCAGCC TTTGTATTCT AAGTTTTAGG AATAAGAATT ATTGGGATAT TCTTTTTTCT TTCAAAAAAG TAATGGGCTT
TCTATCTAAT ACTATTTTGT GCACTAGTTA TCACACTGTA AATTCGTCAT ATCATTCAGC AGAATAATTA CCGCTTTCTC
GTTATACAAG AAGAATGATG TAGAACAAGT AGAAAGTCTA TAAAAGACCA AAAAGATGCC AGGTGATCAC ATGAATGCTT
GAATGAGTAA TGCAGTTTAT CCCCTTTTTA GTCCTTGAAA AAGGCGAGAC AACCATAATC ATGTCCTTTG CATGAACTCT
ACTTAAGCAA CACATTTACT TTCTTTGAAA CTCCATTCAA TTTCCTTGTT TTATGAATTA ATGATACCTG ACCATGATGA
GTCATCTGTt ttagttgttc ttttttccac tggaaaacag taggggagcc ccctactgta tatattaatC TGTTTTTGTT
TTTCGTTTGA ATTTTGTTTT TTATCATGTT TTCCAAGCAA TGGATGTTTT TGGCTAAAGT TAATAAGTTA TTACATGTAT
TGTTGACAGT TCCCTTGGAA GGAAGTTGTT CTTTTGCCTG TGCAGTGGCA TGCTTTAGCA CTAGGTTTGT TTGCATCAAT
AATAGCACCT TTTGGAGGTT TCTTTGCAAG TGGCTTCAAG AGGGCCTTTA AAATAAAGGT AAGCAGTGCC TCCTTTTGCT
TCCTCGGGAT TACTTCTTGA AGTATGGAAA CTGTACTGTT TTTATTTCTG TTGATCACTC TTTTGATGTG GTAGGATTTT
GGAGACAGCA TACCTGGGCA TGGTGGGATT ACTGACCGAA TGGATTGTCA GGTAAGTAAT CTCGAAGAAT ATTCTAATTA
TAAGAAAATG TCACTGCCCA TATAATATAC ATACATATGA AAGCGATATG TGTTTCTATA TACATATTGT AGCTATATGA
AATTTGTTAG GGGCCTGTTG TCAAGTTATT TGCCTGTGAA CTCCACTGTG GCAAGTTGTT TTTGGCTAGC TTTCTTGTAT
TTCCCTGTGT TACGAATTTC CCCTCTGAGC TAGCTAGATG TGCCAAAGTT TTAAGCCCTA TTTTCCTTCA CTTTACTGTT
ATTCTGACTA ATGTTAATAG AAAGCAAGTA CATAGCAAAT AAGTCCTTTA TACCGAGTAT TAACAATAGA ATTTAAAAAT
AGCTTCTGCA GAATCTTTAC TCCTTTTAAA AGAAATACTA GTGATGGTGC TGGTTGTGAA TCTGCCGCTC GCCCACTTCA
ACTTCTCTAC ATTGCACTTA TGATTGCCCT TTAATTTCTC TCTTATTTTT TTAACATTAC ACAATATTCT TCCACATGTA
GTTTTCTTAT TTTCTGGCTT TAGAAAATTC AAATTTGACA TGGAAATTTT CAAGATGACA AAGTTGTCAC TTATATACAT
AGAAAAGCCG AAATAGATGT TTGATGCTAA CATCACATTC ATTTATTCTG GTCAGTATTA GACATGCATG ATTATTTTTT
ATCATCCTAA CAAGCTTTCA TGTTGCAAGT TGCTAAACTT GTTCCTGTTC ATTTTCCCCA GATGGTTATG GCAGTTTTTG
CATACATATA TCACCAATCA TTCATATCGC CCCAAAACTA CTCTGTTGAG CTAATCTTGG AACAGGTCAG GACCATGCTT
CATTTGAGCC TGTTTACTAT TGTCTTGTGT GATTCTTATG CATTTCCGAT CTTTTGTCAT CCAGATTCTA AGAAATCTAA
CCTTTGAGGA GCAGAAATTC TTATATCAGC AGCTTGGGGA AATCTACCGT GAAAGGCAAT TAATGCAGAG CTGAGAACTA
GTTTGCTTAT GATGAAGCAT ACAGTATGTT GTTTTTGAGC GCTCGGTTCC ATGTATAGCA GCATAGCTTC TCTGTACGGC
GATAGAGCAA CGTCCCTTTC CAAACCATTG TACAGAATAG AGTGTGGATG GGGTTTAGCG ATTTAGGTAC TTGATTCGCT
CTCCACTTAC GTTGCCTTCT CTGGCGATCG GTTTATCCTT TTACGCTAAT TCTCATCATT TCTGCCCTTG TAACAAGGGA
ACCGGAAAAG GTTGTATTCG TGTATATCAC TTCGTGTGTT GGCCTCACAT CAAATATGTG CAAGATGCAC AAGATAACAC
AGGAAATGAG GAAAATTTAT TCCCCTTTTA AAAGATATTT TCGTGGT

Locus: Os01g0758400

Loading...

Locus: Os01g0758400

Loading...