Os01t0766900-01

Locus

Os01g0766900

Description

Hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLC1

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE C1

Oryzabase Gene Symbol Synonym(s)

OsCslC1, OsCSLC1

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK110759 (DDBJ, Best hit)

Protein Evidence

GeneMark

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

002-170-H04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0766900-01)

Others

Oryzabase (9066)

Transcript

912 bp

>Os01t0766900-01 Hypothetical protein.
cccatgacaatgtttgtccctgaagctgagctccctgcatgggtggtgtgctacattcca
gcaaccatgtccttgctgaatattctcccagcacccaaatccttcccatttattgttccc
taccttctgtttgagaataccatgtcagtgacaaaattcaatgccatgatttctggcttg
ttccagctcgggagcgcctacgagtgggttgtgaccaagaaatcgggccgttcttctgag
ggcgatctcgtttctcttgttgagaagcagcctaagcaacagagagttgggtctgcaccc
aaccttgattccctagcgaaggagtcccatccgaaaaaggattcgaaaaagaaaaaacac
aataggatataccagaaggagctggcactctccttccttctattaacagcagcagctcga
agcctgctctcggtgcaaggcatacatttctacttccttctgttccaaggggtctcattc
ttggttgtcggcctcgacttgatcggcgagcaagtcgagtgatagaatacatgtggtata
atcggtttctttttttctttggagggggatatgcaatcaaagagaagttctggtaaaggg
aaaacgatacaatattgatgcaaagacaagaagctctggtcccattgatggggggttaca
attcatcggagactctgaattgttgggggtgtagatatatggcttttggagtcggcctgc
aatgatggtctttgatgtctcaattcttttgtaagaattctcagtggttagaatgggttg
tttctacttacttgacagtttaccttcaaatggagatactgttattttaaatgtactttg
gccgatcaCTATGGATGCATACTGTGGTACTCAATAGTACACCTTTTGATGAAAGATAGT
AATGAGAAACCC

CDS

519 bp

>Os01t0766900-01 Hypothetical protein.
atgacaatgtttgtccctgaagctgagctccctgcatgggtggtgtgctacattccagca
accatgtccttgctgaatattctcccagcacccaaatccttcccatttattgttccctac
cttctgtttgagaataccatgtcagtgacaaaattcaatgccatgatttctggcttgttc
cagctcgggagcgcctacgagtgggttgtgaccaagaaatcgggccgttcttctgagggc
gatctcgtttctcttgttgagaagcagcctaagcaacagagagttgggtctgcacccaac
cttgattccctagcgaaggagtcccatccgaaaaaggattcgaaaaagaaaaaacacaat
aggatataccagaaggagctggcactctccttccttctattaacagcagcagctcgaagc
ctgctctcggtgcaaggcatacatttctacttccttctgttccaaggggtctcattcttg
gttgtcggcctcgacttgatcggcgagcaagtcgagtga

Protein

173 aa

>Os01t0766900-01 Hypothetical protein.
MTMFVPEAELPAWVVCYIPATMSLLNILPAPKSFPFIVPYLLFENTMSVTKFNAMISGLF
QLGSAYEWVVTKKSGRSSEGDLVSLVEKQPKQQRVGSAPNLDSLAKESHPKKDSKKKKHN
RIYQKELALSFLLLTAAARSLLSVQGIHFYFLLFQGVSFLVVGLDLIGEQVE*

5'UTR

chr01:32319525..32319527 (- strand) : 3 bp

CDS

chr01:32319006..32319524 (- strand) : 519 bp

3'UTR

chr01:32318616..32319005 (- strand) : 390 bp

FASTA

>Os01t0766900-01 class=Sequence position=chr01:32318616..32319527 (- strand)
cccatgacaa tgtttgtccc tgaagctgag ctccctgcat gggtggtgtg ctacattcca gcaaccatgt ccttgctgaa
tattctccca gcacccaaat ccttcccatt tattgttccc taccttctgt ttgagaatac catgtcagtg acaaaattca
atgccatgat ttctggcttg ttccagctcg ggagcgccta cgagtgggtt gtgaccaaga aatcgggccg ttcttctgag
ggcgatctcg tttctcttgt tgagaagcag cctaagcaac agagagttgg gtctgcaccc aaccttgatt ccctagcgaa
ggagtcccat ccgaaaaagg attcgaaaaa gaaaaaacac aataggatat accagaagga gctggcactc tccttccttc
tattaacagc agcagctcga agcctgctct cggtgcaagg catacatttc tacttccttc tgttccaagg ggtctcattc
ttggttgtcg gcctcgactt gatcggcgag caagtcgagt gatagaatac atgtggtata atcggtttct ttttttcttt
ggagggggat atgcaatcaa agagaagttc tggtaaaggg aaaacgatac aatattgatg caaagacaag aagctctggt
cccattgatg gggggttaca attcatcgga gactctgaat tgttgggggt gtagatatat ggcttttgga gtcggcctgc
aatgatggtc tttgatgtct caattctttt gtaagaattc tcagtggtta gaatgggttg tttctactta cttgacagtt
taccttcaaa tggagatact gttattttaa atgtactttg gccgatcaCT ATGGATGCAT ACTGTGGTAC TCAATAGTAC
ACCTTTTGAT GAAAGATAGT AATGAGAAAC CC

Locus: Os01g0766900

Loading...

Locus: Os01g0766900

Loading...