Os01t0771400-00

Locus

Os01g0771400

Description

Similar to CM0545.290.nc protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsM2, M2, OsM2a, OsUBP5-1, UBP5-1, OsUBP7, UBP7

Oryzabase Gene Name Synonym(s)

single domain MDC protein 2, single MATH domain containing protein 2, ubiquitin-specific processing protease 5-1, Ubiquitin-specific protease 7

Transcript Evidence

AK370602 (DDBJ)

Protein Evidence

B0BLB2 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: ubiquitin-dependent protein catabolic process (GO:0006511)

Molecular Function: ubiquitin thiolesterase activity (GO:0004221)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 (IPR001394)

MATH (IPR002083)

TRAF-like (IPR008974)

TRAF-type (IPR013322)

Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site (IPR018200)

Peptidase C19 domain (IPR024729)

Expression Databases

TENOR (Os01t0771400-00)

Others

Oryzabase (21183)

Transcript

3442 bp

>Os01t0771400-00 Similar to CM0545.290.nc protein.
ATGGTTGTGCGCTTCGAGATGGTTTCTATTAGGGTTTGGGTGTTTTTTTTTACTGAGATG
CGGTGGAGATTTACAAAGGTTTGGGTTTTGGTTGCATGTCCTGTTGTTTGCAGCTCCTGC
AGCAGGACCAGGATGAGGAGATGCTGGTGCCAGACCAGGATGTTGTTGTTGAGGGACCTC
AGCCGATGGAAGGTGAGATTTCTCTACTCTGGATCAACAGTTGAGAACGAGCAGGTACCA
GAAACCTCTACGTCCAGATTTACGTGGACCATTGAAGATTTTTCGAATCACAGAAAGCTG
TACTCTGATGTTTTTGTGGTTGGGGGGCACAAATGGCGGGTGTTAGTTTTTCCAACTGGA
AACAGTGTACAGTCCCTTTCGATGTACCTAGATATTGCTGACGCAAATGAACAGCCTCAT
GGATGGAGTAAATATGCACAGTTCAGCCTTGCTGTGATCAACCAGTTAGACAGCAAGTAC
TCACTAAGAAAAGAAGCAGCACATCATTTCAGTACTCGGGAAAGTGATTGGGGCTTCACT
TCTTTTATGCATTTAGGAGATCTATATGATCCGACTAAAGGTTATATTGTGAATGATAAA
TGCATTATTGAGGCTGAGGTTGCTGTGCGTAAAATAGTTGATTTCTGGAATTATGATTCC
AAAAAGGAGACTGGCTATGTTGGCCTTAAGAATCAAGGGGCTACATGCTACATGAATTCT
CTTCTTCAGACGCTTTACCATATTCCGTACTTCCGAAAGGCTGTATACCATATGCCAACT
ACAGAGAATGATACACCTTGCGGGAGCATCCCTTTGGCTTTGCAAAGTCTTTTCTGCAAA
CTTCAGCATAGTGACAATAGTGTTTCTACAAAAGAGCTTACCAAATCTTTTGGATGGGAT
ACCGTTGATTCTTTCCTGCAGCATGATGTTCAAGAACTGAATCGTGTTCTCTGCGAAAAA
CTGGAAAACAAAATGAAGGGAACTACTGTGGAAGGGACAATTCAACAGCTATTTGAAGGT
CATCATATGAATTATATTGAGTGCATTAATGTTGACTACAAATCTACAAGGAAAGAATCA
TTCTATGATCTTGCACTTGATGTCAAGGGCTGTTCAGATGTTTATGCATCATTTGATAAG
TATGTTGAAGTAGAGAGATTGGAAGGTGATAATAAATACCAGTCTGAGAAACATGGTTTG
CAGGATGCCAAGAAAGGGATGCTTTTTATTGACTTCCCTCCAGTCCTGCAAGTTCAATTA
AAGCGGTTTGAATATGATTTTGTGCGGGATACCATGGTTAAGATAAATGACCGCTATGAG
TTCCCATTACAATTAGATCTTGACAAGGATGATGGAAAATACCTCTCTCCAGAAGCTGAC
AGGAGGGTGCGTAACCTCTATACTCTACACAGCGTACTTGTTCATAGTGGTGGTGGTCAT
GGTGGACACTACTACGCCTTTATACGCCCGGCACTTTCAGATATATGGTACAAGTTTGAT
GATGAACGAGTGACAAAAGAAGACATGAAGCGGGCATTAGAGGAGCAATACGGTGGCGAG
GAAGAGCTCCCACATACCAATCCTGGATTGAATACCACCCCGCTTAGGTTTACTAAGCAT
TCAAATGCTTACATGCTTGTGTACATTCGTGAAAGTGACAGAGAAAAAATTATTTGCAAT
TTAGATGAAAACGACATACCAGAACACCTTAAGATTAGGTTGAGAAAAGAAAATGAAGAA
AGAGAGTATAAGAAAAAGGAGAAAGCAGAGGCCCACATGTTCACTGCATTAAAGGTTGCC
CGAGATTCTGATTTTGCAGAGCAAATTGGAAAACATATATATTTTGATCTTGTGGATTAT
GACAACATCCAAAGCCTTCGGGCACCTAAACATTTGACAATAAACCAGGCCAAGGTCGAT
TTATCAAAAGAATTTGGTATTCCTGTACAATCCCAACGATTTTGGTTATGGGCTAAGCGA
CAGAACCACACATTTAGACCCGTACGCCCGTTGACTCTCCAGGAGGAAGCATCTAGTATT
GGACACCTTACAGATCCATCAAATAAATCACTCAATTCTGAGTTGAAACTGTTCTTGGAG
GTTGCATTGGGACAGGAAAATCATCCTATTTCTGTGCCTCCAAAGACAAAGGATGACATA
TTAATATTCTTCAAGCTGTATGATCCTGAAAAGGAAGAGCTAAGATATGTTGGAAAACTT
CTTGTGAAAGCATCAGGGAAGCCAGCTGATATAGTGCAAAAATTGCAAGAGATGGCAGGG
TTTCAGTCAGATGAAGATATTGAACTGTATGAGGAAGTAATGTTCGAGCCAAGTGTAATG
TGTGAACCTATTAACATTAATGATTCCTTCCTTTCAAGCCAGCTTGAAGATGGTGACATT
ATATGCTACCAAAAACGTTGTTCTCCAGAAAAGTTGGACCACTATCGCTGTGCCGATGTG
CCATCTTTCTTTGAATATATCCAAAATAGACAGGTTGTCCACTTCAGATTACTTGAGAAT
CCAAAAGATGATGACTTCACTTTGGAGCTTTCAAAGCGTTTCACGTATGATGATGTTGTT
GAAAAAGTTGCTAATCAACTTGGACTCGATGATCCTTCCAAACTCCGCCTTACACAACAC
CTCCCGTATTCACAGATGCCCAAATCTCACTACATTAAGTATAGAGGTCTTGATCATCTT
TCGGACATGCTAAGGAATGGCAATCAGATGTCTGACATATTGTATTATGAGATACTGGAC
ATCCCTTTGCCAGTACTGCAAGATCTGATAACATTGAGAGTTGCCTTTTATCATGCTACA
AACAATGAGGTGTCATCTCACTTTATACGGTTGCCAAAAGGTAGCACTATGTCTGATTTG
ATTGAGGACATGAAATCCAAGGTGAATCAACTGCTAGTTTTCTTTCAAGTGTTGTGTGTG
CATGGCAATTTAATGATTTTTTTTCAGGTTGAGTTATCTTATAGTGATGCTGAATTCCGG
TTATTTGAGGTCTACAAAAACAAGATACGCAAGGTATTTCAACAGTTCTTCTGTAATTCT
TAAAGGCTTATTCTTAGGGTAGAGACCATTACACACAAAAAAAAAATACTGCAAAGCTCG
TTTCTGAAACTGGAGGAACCTTTCTTCTTTCTTATCCGTGATGGTGAGACATTATCAGAT
ATCAAAGTGCGTATTCAGAAGAAACTTCTGGTTTCTGATGAGCAGTTTGCGAAGTGGAAA
TTTGCTTATATTGCTCACAATCGCCTGGCTGGTGAATACTTTCAAGATTCAGATATCGTA
TTGAGCCGATTCCAGAAAGATGTTTATGGACCATGGGAACAATGCCTAGGACTTGAGCAC
TCAGACGTCACCCCAAAAAGGTCATGCTTGTCCAATCAGAACCGCAATTCTTTCGATAAG
GCTGTGAAGATTTTCAACTAGA

CDS

3063 bp

>Os01t0771400-00 Similar to CM0545.290.nc protein.
ATGGTTGTGCGCTTCGAGATGGTTTCTATTAGGGTTTGGGTGTTTTTTTTTACTGAGATG
CGGTGGAGATTTACAAAGGTTTGGGTTTTGGTTGCATGTCCTGTTGTTTGCAGCTCCTGC
AGCAGGACCAGGATGAGGAGATGCTGGTGCCAGACCAGGATGTTGTTGTTGAGGGACCTC
AGCCGATGGAAGGTGAGATTTCTCTACTCTGGATCAACAGTTGAGAACGAGCAGGTACCA
GAAACCTCTACGTCCAGATTTACGTGGACCATTGAAGATTTTTCGAATCACAGAAAGCTG
TACTCTGATGTTTTTGTGGTTGGGGGGCACAAATGGCGGGTGTTAGTTTTTCCAACTGGA
AACAGTGTACAGTCCCTTTCGATGTACCTAGATATTGCTGACGCAAATGAACAGCCTCAT
GGATGGAGTAAATATGCACAGTTCAGCCTTGCTGTGATCAACCAGTTAGACAGCAAGTAC
TCACTAAGAAAAGAAGCAGCACATCATTTCAGTACTCGGGAAAGTGATTGGGGCTTCACT
TCTTTTATGCATTTAGGAGATCTATATGATCCGACTAAAGGTTATATTGTGAATGATAAA
TGCATTATTGAGGCTGAGGTTGCTGTGCGTAAAATAGTTGATTTCTGGAATTATGATTCC
AAAAAGGAGACTGGCTATGTTGGCCTTAAGAATCAAGGGGCTACATGCTACATGAATTCT
CTTCTTCAGACGCTTTACCATATTCCGTACTTCCGAAAGGCTGTATACCATATGCCAACT
ACAGAGAATGATACACCTTGCGGGAGCATCCCTTTGGCTTTGCAAAGTCTTTTCTGCAAA
CTTCAGCATAGTGACAATAGTGTTTCTACAAAAGAGCTTACCAAATCTTTTGGATGGGAT
ACCGTTGATTCTTTCCTGCAGCATGATGTTCAAGAACTGAATCGTGTTCTCTGCGAAAAA
CTGGAAAACAAAATGAAGGGAACTACTGTGGAAGGGACAATTCAACAGCTATTTGAAGGT
CATCATATGAATTATATTGAGTGCATTAATGTTGACTACAAATCTACAAGGAAAGAATCA
TTCTATGATCTTGCACTTGATGTCAAGGGCTGTTCAGATGTTTATGCATCATTTGATAAG
TATGTTGAAGTAGAGAGATTGGAAGGTGATAATAAATACCAGTCTGAGAAACATGGTTTG
CAGGATGCCAAGAAAGGGATGCTTTTTATTGACTTCCCTCCAGTCCTGCAAGTTCAATTA
AAGCGGTTTGAATATGATTTTGTGCGGGATACCATGGTTAAGATAAATGACCGCTATGAG
TTCCCATTACAATTAGATCTTGACAAGGATGATGGAAAATACCTCTCTCCAGAAGCTGAC
AGGAGGGTGCGTAACCTCTATACTCTACACAGCGTACTTGTTCATAGTGGTGGTGGTCAT
GGTGGACACTACTACGCCTTTATACGCCCGGCACTTTCAGATATATGGTACAAGTTTGAT
GATGAACGAGTGACAAAAGAAGACATGAAGCGGGCATTAGAGGAGCAATACGGTGGCGAG
GAAGAGCTCCCACATACCAATCCTGGATTGAATACCACCCCGCTTAGGTTTACTAAGCAT
TCAAATGCTTACATGCTTGTGTACATTCGTGAAAGTGACAGAGAAAAAATTATTTGCAAT
TTAGATGAAAACGACATACCAGAACACCTTAAGATTAGGTTGAGAAAAGAAAATGAAGAA
AGAGAGTATAAGAAAAAGGAGAAAGCAGAGGCCCACATGTTCACTGCATTAAAGGTTGCC
CGAGATTCTGATTTTGCAGAGCAAATTGGAAAACATATATATTTTGATCTTGTGGATTAT
GACAACATCCAAAGCCTTCGGGCACCTAAACATTTGACAATAAACCAGGCCAAGGTCGAT
TTATCAAAAGAATTTGGTATTCCTGTACAATCCCAACGATTTTGGTTATGGGCTAAGCGA
CAGAACCACACATTTAGACCCGTACGCCCGTTGACTCTCCAGGAGGAAGCATCTAGTATT
GGACACCTTACAGATCCATCAAATAAATCACTCAATTCTGAGTTGAAACTGTTCTTGGAG
GTTGCATTGGGACAGGAAAATCATCCTATTTCTGTGCCTCCAAAGACAAAGGATGACATA
TTAATATTCTTCAAGCTGTATGATCCTGAAAAGGAAGAGCTAAGATATGTTGGAAAACTT
CTTGTGAAAGCATCAGGGAAGCCAGCTGATATAGTGCAAAAATTGCAAGAGATGGCAGGG
TTTCAGTCAGATGAAGATATTGAACTGTATGAGGAAGTAATGTTCGAGCCAAGTGTAATG
TGTGAACCTATTAACATTAATGATTCCTTCCTTTCAAGCCAGCTTGAAGATGGTGACATT
ATATGCTACCAAAAACGTTGTTCTCCAGAAAAGTTGGACCACTATCGCTGTGCCGATGTG
CCATCTTTCTTTGAATATATCCAAAATAGACAGGTTGTCCACTTCAGATTACTTGAGAAT
CCAAAAGATGATGACTTCACTTTGGAGCTTTCAAAGCGTTTCACGTATGATGATGTTGTT
GAAAAAGTTGCTAATCAACTTGGACTCGATGATCCTTCCAAACTCCGCCTTACACAACAC
CTCCCGTATTCACAGATGCCCAAATCTCACTACATTAAGTATAGAGGTCTTGATCATCTT
TCGGACATGCTAAGGAATGGCAATCAGATGTCTGACATATTGTATTATGAGATACTGGAC
ATCCCTTTGCCAGTACTGCAAGATCTGATAACATTGAGAGTTGCCTTTTATCATGCTACA
AACAATGAGGTGTCATCTCACTTTATACGGTTGCCAAAAGGTAGCACTATGTCTGATTTG
ATTGAGGACATGAAATCCAAGGTGAATCAACTGCTAGTTTTCTTTCAAGTGTTGTGTGTG
CATGGCAATTTAATGATTTTTTTTCAGGTTGAGTTATCTTATAGTGATGCTGAATTCCGG
TTATTTGAGGTCTACAAAAACAAGATACGCAAGGTATTTCAACAGTTCTTCTGTAATTCT
TAA

Protein

1021 aa

>Os01t0771400-00 Similar to CM0545.290.nc protein.
MVVRFEMVSIRVWVFFFTEMRWRFTKVWVLVACPVVCSSCSRTRMRRCWCQTRMLLLRDL
SRWKVRFLYSGSTVENEQVPETSTSRFTWTIEDFSNHRKLYSDVFVVGGHKWRVLVFPTG
NSVQSLSMYLDIADANEQPHGWSKYAQFSLAVINQLDSKYSLRKEAAHHFSTRESDWGFT
SFMHLGDLYDPTKGYIVNDKCIIEAEVAVRKIVDFWNYDSKKETGYVGLKNQGATCYMNS
LLQTLYHIPYFRKAVYHMPTTENDTPCGSIPLALQSLFCKLQHSDNSVSTKELTKSFGWD
TVDSFLQHDVQELNRVLCEKLENKMKGTTVEGTIQQLFEGHHMNYIECINVDYKSTRKES
FYDLALDVKGCSDVYASFDKYVEVERLEGDNKYQSEKHGLQDAKKGMLFIDFPPVLQVQL
KRFEYDFVRDTMVKINDRYEFPLQLDLDKDDGKYLSPEADRRVRNLYTLHSVLVHSGGGH
GGHYYAFIRPALSDIWYKFDDERVTKEDMKRALEEQYGGEEELPHTNPGLNTTPLRFTKH
SNAYMLVYIRESDREKIICNLDENDIPEHLKIRLRKENEEREYKKKEKAEAHMFTALKVA
RDSDFAEQIGKHIYFDLVDYDNIQSLRAPKHLTINQAKVDLSKEFGIPVQSQRFWLWAKR
QNHTFRPVRPLTLQEEASSIGHLTDPSNKSLNSELKLFLEVALGQENHPISVPPKTKDDI
LIFFKLYDPEKEELRYVGKLLVKASGKPADIVQKLQEMAGFQSDEDIELYEEVMFEPSVM
CEPININDSFLSSQLEDGDIICYQKRCSPEKLDHYRCADVPSFFEYIQNRQVVHFRLLEN
PKDDDFTLELSKRFTYDDVVEKVANQLGLDDPSKLRLTQHLPYSQMPKSHYIKYRGLDHL
SDMLRNGNQMSDILYYEILDIPLPVLQDLITLRVAFYHATNNEVSSHFIRLPKGSTMSDL
IEDMKSKVNQLLVFFQVLCVHGNLMIFFQVELSYSDAEFRLFEVYKNKIRKVFQQFFCNS
*

CDS

chr01:32569258..32569462 (- strand) : 205 bp

chr01:32568410..32568539 (- strand) : 130 bp

chr01:32568170..32568327 (- strand) : 158 bp

chr01:32567131..32567396 (- strand) : 266 bp

chr01:32566840..32567058 (- strand) : 219 bp

chr01:32566656..32566764 (- strand) : 109 bp

chr01:32566442..32566557 (- strand) : 116 bp

chr01:32565726..32565824 (- strand) : 99 bp

chr01:32564746..32564855 (- strand) : 110 bp

chr01:32563965..32564039 (- strand) : 75 bp

chr01:32562854..32562932 (- strand) : 79 bp

chr01:32562623..32562769 (- strand) : 147 bp

chr01:32562471..32562551 (- strand) : 81 bp

chr01:32562269..32562388 (- strand) : 120 bp

chr01:32560999..32561121 (- strand) : 123 bp

chr01:32559140..32559217 (- strand) : 78 bp

chr01:32558918..32559006 (- strand) : 89 bp

chr01:32558702..32558810 (- strand) : 109 bp

chr01:32558539..32558607 (- strand) : 69 bp

chr01:32558320..32558430 (- strand) : 111 bp

chr01:32556613..32556668 (- strand) : 56 bp

chr01:32556330..32556507 (- strand) : 178 bp

chr01:32556145..32556246 (- strand) : 102 bp

chr01:32555834..32556067 (- strand) : 234 bp

3'UTR

chr01:32555761..32555833 (- strand) : 73 bp

chr01:32553876..32553973 (- strand) : 98 bp

chr01:32553623..32553703 (- strand) : 81 bp

chr01:32553462..32553545 (- strand) : 84 bp

chr01:32553344..32553386 (- strand) : 43 bp

FASTA

>Os01t0771400-00 class=Sequence position=chr01:32553344..32569462 (- strand)
ATGGTTGTGC GCTTCGAGAT GGTTTCTATT AGGGTTTGGG TGTTTTTTTT TACTGAGATG CGGTGGAGAT TTACAAAGGT
TTGGGTTTTG GTTGCATGTC CTGTTGTTTG CAGCTCCTGC AGCAGGACCA GGATGAGGAG ATGCTGGTGC CAGACCAGGA
TGTTGTTGTT GAGGGACCTC AGCCGATGGA AGGTGAGATT TCTCTGTGTT TTTATATTTT TCCTCTGAAT TTAATCTGAT
CTGTTTGTCA AGCTTTGTTA TTAATTGGGT TATATTTTTT TAGGGTGTTA ACTCAGGCCA TTTTTTCATA GTATGTTTCA
TGGGATGCGA CTAGTCTCTA GAACCACTGC CCAAAACATT AATTATGAAT CGTGCATTCA CGCTGTACTT GCAAACTTCT
GGTATTTAGT TTTTTCGGTA CTCGCAAACA ATAGGTTTTG TAAGAATTAC TGAACTCTAC TGGGAGGTCG CCAGGGTCAG
TAGGAGTCCT CGGGCTTGTT CTCCCAAAAA ATAAGTCTAG TTAACTATTG AAGAATGTGC GGTTTGTAAG TTAACTATTG
AAGAATGTGC GGTTTGTTTC CAGATGGTTT TAGCTCTTTG ATTATAAGGT GATAAACATG TCCTGTAGTC CTGTACTATT
GGTTGATGCT AAGGAAAAAA AACAATGCAG AATTCCAGAT GCTGGCTAAG AAACCTGGAA CTTGAAAAGA GTAATATTCC
AATCTACTGA ACATGCTCTG TTTGTTTTTT TTCTTTCCTG GTTGTGTGTT GGTTGTTTTT TGTGGTGGTA CTGGTATACC
TGTCGTTATC AGGTCATTGA AAAATGGGCA TATGCTAATT TTCACCGGTG CATGTGACAC TAGAGTCATG CAATTGTTTA
TCATGTTACT TTTGTTGTTT AACATATTTA TTTCATCTTG CAGACTCTGG ATCAACAGTT GAGAACGAGC AGGTACCAGA
AACCTCTACG TCCAGATTTA CGTGGACCAT TGAAGATTTT TCGAATCACA GAAAGCTGTA CTCTGATGTT TTTGTGGTTG
GGGGGCACAA ATGGTGAGTA AAAACGGTTT TTTGTTGCTT CTTATCATGC ACCACTAGTC GTAGCTTAAT TTGGTGCTCC
TATACCTCCT TGCAGGCGGG TGTTAGTTTT TCCAACTGGA AACAGTGTAC AGTCCCTTTC GATGTACCTA GATATTGCTG
ACGCAAATGA ACAGCCTCAT GGATGGAGTA AATATGCACA GTTCAGCCTT GCTGTGATCA ACCAGTTAGA CAGCAAGTAC
TCACTAAGAA AAGGTAATTC CTGTTATCTC TTGCCTGATT AGATATGCTT ATCTGAAAGT GTTATTGTTT AGTTTGAGAT
TGCTAGCAAT ATTTTGTATG ATATAAAAAG TAAAAGTGTG GTACAAACTG AATTTGCTTT GTAGCCAAAT TAACAAATTG
ACTTCATGTG CTTTACAAAT AATTACATTT ATCTTAGATC CTCCAATGCT AGAAGTATTA AGATCGTGTA TATAAGAGAA
GAGAAATAAT AGATCAAtga tccaaatgct aaaaccaatt gaggtgatgt gataagcttc atgagagaag atggaattgc
actgtagatg aatgatctct agaaacaatt gagatgatgt ggcttcatga gagaagagaa gattagcatt aactacttta
tatataggat taatcTAGCT TGGTTTTCCT AAAGTAAAAC AGATGGCCTT TTGAGAGGAT ACGTTTAAAC GGCTGCTCTA
CTATCTTATG TTATGCCCTG AAAGTTAATA TATTTTGATG CAATATACAA TCACATAGAT ATATTCTCCT GAAATGTATG
TCACAGGATT GTTTTTAATC CCCCTCAGAT CAGCATGAAA AATTGAGAAA ATAAGATATT AAATAAACTA GCTTGCCAGT
TTTTTCTTCT CCATGTTAGT TGAGAGAAAT TTTCTGCTTG CGTGCAATAG TTTTTTAATT CAACTTACAT ATAAAGCTTT
AGTTTTAAGC ACAATACTTT ATGAATTTCA CCAGTCGTTA TTCATGAGTT TCCTTCCCCT CCACAGAAGC AGCACATCAT
TTCAGTACTC GGGAAAGTGA TTGGGGCTTC ACTTCTTTTA TGCATTTAGG AGATCTATAT GATCCGACTA AAGGTTATAT
TGTGAATGAT AAATGCATTA TTGAGGCTGA GGTTGCTGTG CGTAAAATAG TTGATTTCTG GAATTATGAT TCCAAAAAGG
AGACTGGCTA TGTTGGCCTT AAGAATCAAG GGGCTACATG CTACATGAAT TCTCTTCTTC AGACGCTTTA CCATATTCCG
TACTTCCGAA AGGTGAGGCT AAATTTGTAA ATTCTCTTAA ATGAATCCTA TGATGCGAGG CTGATACAGA GAATGATATT
TTAGGCTGTA TACCATATGC CAACTACAGA GAATGATACA CCTTGCGGGA GCATCCCTTT GGCTTTGCAA AGTCTTTTCT
GCAAACTTCA GCATAGTGAC AATAGTGTTT CTACAAAAGA GCTTACCAAA TCTTTTGGAT GGGATACCGT TGATTCTTTC
CTGCAGCATG ATGTTCAAGA ACTGAATCGT GTTCTCTGCG AAAAACTGGA AAACAAAATG AAGGTTGGAC ATTTATTTTT
GTTATATGTA AGATAATAAA TAGTGTTTCA TCAATGTACA ACTACTCTCT CGATTCAGGG AACTACTGTG GAAGGGACAA
TTCAACAGCT ATTTGAAGGT CATCATATGA ATTATATTGA GTGCATTAAT GTTGACTACA AATCTACAAG GAAAGAATCA
TTCTATGGTA GGTGACAAGG TGAAATCTGG ACCTTGTTTC TTTATTGTTT TTATCTATTC ATCATGATTG TAGATTTATC
ATGTATTTTC GTAACTCTTT TCTAGATCTT GCACTTGATG TCAAGGGCTG TTCAGATGTT TATGCATCAT TTGATAAGTA
TGTTGAAGTA GAGAGATTGG AAGGTGATAA TAAATACCAG TCTGAGAAAC ATGGTTTGCA GGTTGGTCCC ACTGACATTT
GAGATCTAGA ACCTTCAAAT GCCACATTTA CCAATGTTTG GATTTAAATA TTTCTTTGCA GCTGAATTCA TTTTAGGCAA
CACTTTTCCT ATGTTGTTAT GCACAATTCC ATATTGATCT TTCACATGAG CTGTGTTAAA CCTATTCATA TATTATCTAA
GGTTTGATTT GGTCCCAGCC CATCCATGTG GGTAGGCCTG GCTTTTAGTT AAATTCTGGC ACATCCACAA GGACAAGCTA
GGATGTTGGT TTTCCCATCC TAAGGGTAAC TTATGTAAAT ATCATATGCT CATGGCTCAC CCACTGAGTT GCACATTGTT
GAATCTATGT TGAGTGGTTG GGTAGTATTA TTATTCACTA TCCCCAGCGT GCACGGATGT ATCAATTGAA AAAGTGTCAT
CATATTTGAA TGTGACCATG CCAGTGACAT AGCACATCAA TATTATTTTC CACCTCTGGT TGATCTATAA TTTTTTTAAG
TATACTTTAA TGCTAGATTC TTGATAAGGA AAATGTGCTT TGACACATAC AAATTACTTG GTAATGAAGT GACTTTTTAG
ATTGTGTGCT TCAGAACATT TTCGTCCTCT CTTTTCAGGA TGCCAAGAAA GGGATGCTTT TTATTGACTT CCCTCCAGTC
CTGCAAGTTC AATTAAAGCG GTTTGAATAT GATTTTGTGC GGGATACCAT GGTTAAGGTC TGAAATTCAC TCTATATTTT
CTCTGGCTTG TTTCTAGATT TCATCTATGA TTTATCCTTT TCATTGTGGC GCTTGCTAAT ATTTAACATA GGCTACAAAC
GAACTTTTCA TAATGTAGTC TCACATATCA AGGACATGGA AAACTAGATT TTCCAAATTG TGTTTTGCAT GATAAGAGCC
TTAGCTGTCA AGATATGGAG AATTCCCCCT TGAAATTTAG CTTCATTTCC TTGACTTGCT TTTAAAATTC TGAAATATAA
CATGGGCAGC CATGAGAGGA CAAATAATGA TGTCGCATTT GCAATGTCCT TTTGTAACAG AAGATCTTTC TTAATGCAAT
TATGGTTTCC GCTTCTTGTA TTTTTTTTAT GTGTGTGTCC TCATTTCAAC ATAATGGTCA ATGGCTTACA TGCACCAGAA
CATATTTTAA TTTGTCTCCT GAATATCCCA TCTCCACACG AAAAACCTTC TAGATGCGCT GTAGGCTAGG AGTACTTTCT
ATATTTCTTG ATGAAAGTGT GAGCAACAAA ACAAGCAGAA AATAAATTTG CTACAGTGCT GCACATGCCA TTGACACCTT
ATTTTGTTTA TTTACTTGGG TGATCCTCAG GAAGTTCCTT TTTTTAAGGC TAAAAATTAG ATAGAACCTG GTGCTTCAAA
TGTTGAAAAC GAGGGAGTTC GCTTGCAATA TCTCGGATTA ATATCTTCTC ACTGGCTTGA AAATTCCTTA TTTAGTTGCT
TAAAAGTAGG CTTGCTAAAG TTTGGAGGCT CAACTGTATC TTTTACTTTT GAGGGAAACA TGCAAAATAC TTTATACACA
CAATTTTTTC CTGCACTGGT TAAACTAAAC TAATTTGGAC AATGTAGATA AATGACCGCT ATGAGTTCCC ATTACAATTA
GATCTTGACA AGGATGATGG AAAATACCTC TCTCCAGAAG CTGACAGGAG GGTGCGTAAC CTCTATACTC TACACAGGTA
GTTCCAAGCT CTCCATGTGA TTTATGTTTT CTGTTTTGCT TTGTAGTATG TTATACTCTG TCAGTTATCC TGTACTTGCT
TGCTGTTGAT GTTCTAAAAT TTTGATTACT GGCACATGTA GAAGTTGTCA CAGAGAAATA TATTTTTGAC AATTAAAGTA
CCATGATATC ACCATATTTT TACACCAACA TATTATTAGG AAAAAAAAAA GACTATCAAA GACATGTGTT CAAGACTGTT
GCAGTGCATG CATCAGCTAG CTGAGGCTTC AGCTGCACTG CTGTTTTTCT CCTGTATCCT ATGGCCCACA GCCAGCCTGC
TGCGCTTAAA CTCTGCAACC AATGTTAGGA ATGACCACCT TGTTTTCTTT AGTAATTACT TTGGTCTCAC TCGTTCCAGT
TTGAAGTTGT GGCCAGTGTG TATATACTGA TATGGTCCCT TGTATGTCTT GTTTGTGCAT TGACACGCAA TTTGTGTTAC
ATAGCTGTTA CAAATGTCAG TGGTCAGTCA TGTCACATGC TATTTTCAGG CAGAGAACTT AGACAATTTC TTCTACACCC
TTTACTTGTG AAGTTTTTGG ATTGTGTATA GGAAGCATTT CTCAGTTTAG CTTGTCCTGG CTGAGCATAC ATTGGAGTTT
CTGTTGTTAT CGACAAGTGC TTTGGACCCT TACACTAGTC TTAACAACTT GTTTTGAATG CAGCGTACTT GTTCATAGTG
GTGGTGGTCA TGGTGGACAC TACTACGCCT TTATACGCCC GGCACTTTCA GATATATGGT ACATCTAAGT TTAAATAGTG
GAAGCTCTAT GAACTTTATA ACATACTTGA GATATTCCTT TATAGTTAAT CGTCTTATTT TCATCCTAGT TGGCTAATCA
TCAACGGATA AGTTGATCCA TGAAATATGA TATAAAAACC TACTCCCTGC TTTTCATTTT TTTAAACATG GCTGCAATGA
TATCCTATTT TAATGATATC CTCTCTTTCT CGTTGTGAAA CAGTAATACA GTATGCTGTG TTTTATCATT CACAGCAGTT
CATTACTTCA TTTTAGTCAT AGTCAAATGT TATTTATTTA GAAAAGGACT TATGCTTTAA TGACATTGTG AATCACAACG
GTATGTTCTG TAGCTTTAGA TGTTAAACTT TTTGAATAGG TATATTTTTT GATTCTCCTA GCAAATAATT TCTTGTTTAT
TTCTTCATAA AAAACATAAG AATACAAAAT CTGATCCTTT TGCATTAATA GGTATACATA AATGGTCAAT AATTAGCATG
AACGTATTAC TAGAAAATAG GTATACGCTT TCCTATTTTC TTTTTCCCCT GTTGACATGA CTGCTGTCGT CTTGTATTGG
GTAGTAACTT TTTCAGAAAC AAAAAAATAT TACTCGTACA TCAATATTAT AATTAATTTG TTCCAATGAA GCAAGAATAC
ACAATGCACA TCAGGTACTG TTTTGGCAAG TCAGTGACTT GTTGCTGAAT CAGTTCTATG GCTAATATTT TTTGTTGAAC
ATCTGATTCG CATTAGAGGG CAAGACCTAC ATTACTAGGC TTAAAAAGAG ATATCTTATT TTTGTTGTGC TTGCAGGAGT
TCTTTTTATG GATTGATGTG ATTTGCATGA ATATCCTTAA TGACTTTGTA AAGGATCATT CCATTTTTGT TAACATTAGT
TTGAAGATAA GCTTGTTAGA CGATTGCTTT GTTGCTAATA ATGCCCTGCC TTTCTATCTT CAATTTTTTA GCATTCCATT
GGACAGTCAT TTGATGAATT TATGTAATGT TTTGTACTTT CACAATTTAG GTACAAGTTT GATGATGAAC GAGTGACAAA
AGAAGACATG AAGCGGGCAT TAGAGGAGCA ATACGGTGGC GAGGAAGAGG TATATACACA CATGAACACT GGAAGCCCCA
AGTCGGCCTT TTACTTCTAT TAGTTTTATT AATGTCTTTT TTTTCTGTTA CAGCTCCCAC ATACCAATCC TGGATTGAAT
ACCACCCCGC TTAGGTTTAC TAAGCATTCA AATGCTTACA TGCTTGTGTA CATTCGTGAA AGTGACAGAG AAAAAATTAT
TTGCAATTTA GATGAAAACG ACATACCAGA ACACCTTAAG GTAATACTTC TTCCCTTTTC TTTTCTTGGG TATCACAGAA
CTTGTTCTGA TGTCATGAAA ACCTTTACCA GATTAGGTTG AGAAAAGAAA ATGAAGAAAG AGAGTATAAG AAAAAGGAGA
AAGCAGAGGC CCACATGTTC ACTGCATTAA AGGTTTACCT CTTTATTTGA TACGTTACAT TATCTGAAAA TGCTATCATT
CTAGTTGCTC CTCACTTAGT GCTTCATTTT CTAGGTTGCC CGAGATTCTG ATTTTGCAGA GCAAATTGGA AAACATATAT
ATTTTGATCT TGTGGATTAT GACAACATCC AAAGCCTTCG GGCACCTAAA CATTTGACAA TAAACCAGGC CAAGGTAACT
TTTTGCTGAG CCTCATTTGT CATCCATGAT ATATCAAAAT GTGTATATCT AATGAATATA CGATATGCAC AGAATTGTAT
TGCATTGATG ATGCCCCATA ACTACGCTAC AATTTATTTT ATTTTATTTT CCAGTACTTT CTTGAATTCT GGTATTTTAG
TTTTCCATTC TTAAATTTAA AGTGAGTAAC ATTATTTCAT TATTAGCTTA TAAGCCCGAT TGTGTAGTTT GGTGAATCTT
TCACAGGTGT TTAGCTTTGA TCGATCTTGT TGACTCTGTA AAAATAGACC AACTAAGAGT ACAACAAACA TAGTCTATGG
ATATTCTGTG AGAGCAACAC ATTGTCGAAC CTACATGTAT ATGTTTGTTG CATGGAAATG CTATTCAACA CCATTCACCA
AAGATAACTT GAATATATCA ATACAATGAT tttttttttc tcaaatacgc aggagaactg catatcattt cattaaagaa
gaaagaaaac tggaaacagt acaaacacaa accccaaaag acaataaaca aacaagttaa gtctaattgc atgtTGAGTT
TCGCTGGTTT GACTATCCAT AGGTGAAGCA AACAGCTGTG CTTTAGATTT TTCATACACA CAAATATACG CCTCAAATAT
GATTTTCTAA CAAATAATGA GTTATGAAGA GAGTTCATAC TGGGTTAGAT CAGATTCTTA TATTCATAAG CCTAATAACA
TGGTCAAAGA TTTCTTTCTT TGGTTGCCTA TCTTTGCTGG CTCTCTGGAA TACATGTAAT CTCCATTATT GATCTGATAC
AGTGTTGAAA TCAAAATAGT ATAAGAAACA GACTAGCTCA TTTTCTTTTC AGTTATAACC AGTCTCTCGG AGAAATTGTT
TGAAGTCCCA TGTTTGGAAT ATATTATTTA CTGAAAACAT AATGTCTACT TGATTGAATA TGTGTATGCT GTTATTATTA
TTTCTTTATT GCAAGTAGAA AACTGGAACA AATTATATTG CGCTGTTGTT TGACTTCAGT TGCTTTGTTG GGGATCTGCT
TGGTGTTTGT TGCATCAAAA TCTGAACATT TTGTTCATAC TGGAATTTTA TCATGATAGC AAAAAATGTG GTGTTCTGAT
TGAAATATGC TTTCTTGACA GGTCGATTTA TCAAAAGAAT TTGGTATTCC TGTACAATCC CAACGATTTT GGTTATGGGC
TAAGCGACAG AACCACACAT TTAGACCCGT ACGCCCGTTG ACTCTCCAGG AGGAAGCATC TAGTGTAAGT GCAATATTGG
CATTAATTAA CATCATATTA CCTTGCTTGA CAGTAACTGT CCATGCTACC TACATGAAAT CATCAGCCTT GATTTCTTCC
ATTATGTATG AACTTACTCC CTGTGTCCCA AAATAAAAGC ATTCCTCGCA TTGCGATGCA ACTTTAGGgt attggtgatt
gggtaggcaa ggggtattga aggagtaaaa cttctgtatt tgtggaccga gggtaggtta cagagtagaa atgaactcat
tctgtcacaa agtttgaact ctggagatct aacttatttt gggtcggagg gagtaTGATC TTTTAAATCG TCTGATTGTG
ATGAGTGGGC TTATTTTTTT TTTATATATT TACCATGTAA CACACTTTAG CAATATGGTG TACTTTTTAA TACCtactcc
ctccatttca tattataata agttgttttg acttttttcc tagtcaaact tctttatgtt tgactaagtt tataaaaatt
tagcaacatc tacaacacca aattagttcc attaaatata acattgaata tattttgata atatgtttgt tttgtattgg
gaatgttatg atatttttct acaaatttag tcaaactaaa aaagtttgac taggaaaaaa gtcaaagcct cttataatat
gaaacagagg gagtaTAGTT TTCTCTACCA CTTTAAAAGT GGAGTTGTTC TCCACTCCTT TCATTCTACT CCCACCGCAC
GCTCCGAGTT CAATTGCCCT CCTAACCCAT CCTTAATTAT ATGAGCCTCG CCCCTTACAA TGGAAGGGCA TATTGGTACT
AGTATTTATA AAATGGGAGT GGTCAAACTA AAACTATGCG AAACCACAAT TAAAGTGTTG TGCAACAAGG GAGTACTTTG
TTGACTTCAC AACACTATTT CATCCCCACA TCAACACTTT TAGCCATGTC CAAAGTGATG ACTGAAGTGA GCCAGATCAC
AATGCTTGCC AACTTATATC TTCAAGTTTA GGGATGTATG TGGCACTTCA TTACCATTTA AAGACCCATG GTCTTTTTAA
ATGAGTATAG AATAGATGAA GTTTGGTTAA GTAAGGTGTC AGTGGTGGGA GTGATAAACT GGGTAAGAGG ATATAAGAGA
TCAAATATGA TTTCATATGG GAGGCACCAT AGTCCAGTTT GTGGATAATG GATGTGCACT GTTCCTAACC CCAAAAGTTT
CTTGGCTGTA GGTCATCAAG TGTTCCACAT ATGCATAACT TCATAGTCCA GTTTATTCAT AGTATGGTTG AATTTGCCTG
TGAAACTTGG TATGCGCACA TAACATAATT TGCACCATAA AGTTGCTTTT TAGGGAACTT ATCCAGTTTT CCCAATTCTC
CAACGTTGGA GTTGAGGGGA TGCCCCTAGG AGCAGCGGGC ATTTTCTGTT CTTTTAAACT GTTCAAGTAA AGAACTCTTG
TGAAATACAT GGTTTGAGTG TACTGAAACA GAGATTGGTA CCTTGCACTC ATTTTGTGGA ACTAGTAGTT ATGTATACAG
AATACACAGA CAGTTTCTAT ATGCGAGGAT TCAGGTATAT TATTATATCT TGGTTAGATT TATGAGTTAA TAGTGCAACC
AACCAACCAG GCGTGTGGAT ATTGCACTTT GATTAAGCTT ATCTACCTAT TAACATTACT TGATTCAATT TAGAGATCTA
CTTTGTTTTT GTGTTTGTCT TTAGCTTCCA TTTATTTCAT CTATCAGCTC TCTTGACTCG CAATTAATAA ATTTTGTTTC
TGCAGATTGG ACACCTTACA GATCCATCAA ATAAATCACT CAATTCTGAG TTGAAACTGT TCTTGGAGGT TGCATTGGGA
CAGGTTAACT ACTTACTAAA GTGCTTTTTA TTTGCTAAGT CATCTACTCA ATTGTGTTGT GCTACTTGTT TAGCCAAAGT
TCATTGATCT TGGTTTACTT GTGGACAATT TAACCCAGAT TATGACATGT GTACAGGAAA ATCATCCTAT TTCTGTGCCT
CCAAAGACAA AGGATGACAT ATTAATATTC TTCAAGCTGT ATGATCCTGA AAAGGAAGAG CTAAGGTTGT TCCTATCTCT
TGTATATGCA TATAGCTATT TATTTATTTA ATTTACTTCT ATGGGTTACC TGACCAAGCT GCATGGATAT TATCCCTGTT
ATTATGAAAT AGATATGTTG GAAAACTTCT TGTGAAAGCA TCAGGGAAGC CAGCTGATAT AGTGCAAAAA TTGCAAGAGA
TGGCAGGGTT TCAGTCAGAT GAAGATATTG AACTGTATGA GGTTAGTTTT TAGTTACTGG TTCTACTTGA CTATTTTAGT
TAGGCACCAT TTGAGGAGTT GTAAAACTGC AATTTATTTC CCTAATTTTT TGTAGGAAGT AATGTTCGAG CCAAGTGTAA
TGTGTGAACC TATTAACATT AATGATTCCT TCCTTTCAAG CCAGGTTTGT TCTATTAATA TTTTGTTTTT TTCTAACAGA
TTTAGTTTAG CTTTCCAAGA GTTTTAGTTG TCATTTTACT TATCCTGTTT GACTGTCTGG TGTTGATTTA AGCTTGAAGA
TGGTGACATT ATATGCTACC AAAAACGTTG TTCTCCAGAA AAGTTGGACC ACTATCGCTG TGCCGATGTG CCATCTTTCT
TTGAATATAT CCAAAATAGA CAGGTAAATA TATCTGTCCT GGGGATGAAT TGATGCTTTT TCATTTTTCT GTGGACTGTT
ATCTTATCTT CTTTTTTTGT CCTTCAGTCA GTAACAGTTG CAACAGACCT TTGCTTGTTC TGTTTTCCCC ATTATCCTTA
TGGATGCCAA TAACTAAAAT CTGCTAATTA AGAAAAAGAA GTCGAATAAC TCGCGAATGG GATAATGGGA TAGACTAGAG
ACAAACTTTC CAACAGCCTC ACTTTCAAGT GATCAAGGCA CCACTGGTAC CAGTGGGCTG AAGGCTATTT CAGAATTGAA
AAAAAAAGAG TAAAGTCAAG CTACTTCTAA TATTaggatt gctaaaagga aaataacggc tcagctggtg aggagtaaga
cctcggtctg attagctagt tggtgaggca agcttaccaa aacgatgatc CTTCTGGCAA AGCCTAGCCA CTCTGACCCA
CCGAGCCAAA AGGAAAGAAA AAGAAGTAAA GAACAGTGCA GAACAGCCGG TTAGCTCGGG TAGTCGTATT ATCATTTTTT
TTCTATGCCC TGTTAAATTG TTAGCATAAT CTTTGTTTGG ATTGATACGT TTGAACATGG AATTCCTTAC TTCTTCATGG
ATTAGAATAT TACCAGTAGA GTAGTCTGGC TTTGTTTGTC TTGTATGTTT TTCCATAGGG AACATACCTT TGCCCAAGTT
GGTGGTATGG TGCTGTCCTG TTTGCATGTT GGGTGTGCTT GTGGGTGACA TGGTTTGGGG TGTGTACATT GCCATTTGCC
AATATAACCA ATATGGCCTG CTTGGAGAAA CCGAGAAAGA AAGGCACTTT ACACCATAAC CGCCAGCTAA TTTTAAGGAA
TGAAATATGT GTAATCACAC AAATAATTAT GTTAACTTTA TCACTTGAAC AAAGAGAATT GTTGTGACCA TATTTCAGTG
CAAGCCTCCT AAATGTGATC AAATTCTAAT ATCTATAGCT TCTCTTTTTT AGCTCTTTTC TGCTAATACA TTCTCTGTCT
TGATACACTG CTATATTTCT TTTAGCTCCT TTGATTTTTT TTATTCCTCC TTTTTTTTTA TGCAATTCAT TTGTTGTGGT
TTGTGCCACT AGCCACTGTA ATGTCTATTT TGTTCACTAT GTAAGCATAC TGGTATATGG AGCAAACAGT TTTCTTGTGT
CATGCTCCAG TGCTCCATCC ATTACAAAAT ACTCTCTTAA AAATAGATAT GTTTTATGTA TTCACATCCG ATAGCTCCTG
TCGGATCTCT ATTCTCAGTC ACACTTCATC CCTAAGTTTA ACATGTTTGA GCGTAGAGCT CTAGATTGGA GCTGTAAGAA
GAGAGTAAAG AATATCAGAA CCATGTAGTT ATTTTTCCCT TTCTGGAAAG CTGAATTATG TTGGCAAGGC TGTATGATTT
TAAATATATA TGTGGTCTTC CTGAAAAGTC AATGACATTG TGCAATGGAA GAAATATGTG TGTCTGTAGG GTGTTGGGCG
CTGCTTCATT AAGGTTTATG GTATCTGTAG TGAAACATGG AACAACTACC CTTTCAAATA ATTCCTTTTC GCAAAAAAAC
AGATTCCTGT CTGAATTTTC TGTATATTTC ATTTATTATT TCCCACAAGT GGAATTTATT GTTGTTATCT ACAGGTTGTC
CACTTCAGAT TACTTGAGAA TCCAAAAGAT GATGACTTCA CTTTGGAGCT GTATGTGCCA GGAATATTTG AACATACATA
TAATAACTGA CATACCTCCT TTGTCTGTGA TATGACTCAC TGTTTTTTTC CCCTCCTATT TTCATATTTG TGAAGTTCAA
AGCGTTTCAC GTATGATGAT GTTGTTGAAA AAGTTGCTAA TCAACTTGGA CTCGATGATC CTTCCAAACT CCGCCTTACA
CAACACCTCC CGTATTCACA GATGCCCAAA TCTCACTACA TTAAGTATAG AGGTCTTGAT CATCTTTCGG ACATGCTAAG
GAATGGCAAT CAGGTTTGGC AGCTTTATGG AGTATTCTGA GCAACTTCTT TTGTGCCTTT TACATGAAAT TACTTGCGCT
TCCTTTGGTT TGGCAGATGT CTGACATATT GTATTATGAG ATACTGGACA TCCCTTTGCC AGTACTGCAA GATCTGATAA
CATTGAGAGT TGCCTTTTAT CATGCTACAA ACAATGAGGT TTGTTTGAAC TCGTTTTGTG CTTGTAACCA CTTCTATATT
TCTGATCATG TCCTGTGCTA ATGCTTACTT ATCAGGTGTC ATCTCACTTT ATACGGTTGC CAAAAGGTAG CACTATGTCT
GATTTGATTG AGGACATGAA ATCCAAGGTG AATCAACTGC TAGTTTTCTT TCAAGTGTTG TGTGTGCATG GCAATTTAAT
GATTTTTTTT CAGGTTGAGT TATCTTATAG TGATGCTGAA TTCCGGTTAT TTGAGGTCTA CAAAAACAAG ATACGCAAGG
TATTTCAACA GTTCTTCTGT AATTCTTAAA GGCTTATTCT TAGGGTAGAG ACCATTACAC ACAAAAAAAA AATACTGCAA
AGCTCGTTTC TGAAACTGGA GGGTTGTATT GTTGTAGAAA ATCAGTTCCT GCTGTAAAAT AACAAAGATC TCTCTGTTTG
AGTTGATAGA TTTTTTCTTT CACTTTGATT ACGAAAGGTA GTCAACCTGG CAGGTTTTGC CTGACTCTTC CAAGTTTTAC
CAAAAATCAC GTCATATGCT CTTTAAGAAA AACACATAAT GCTCACGTCA TGATTTCATT TTACCATGTA AAGTTTCATC
CCTGCTTTCA TCGTAGAAAA CAATATTTTC TATTCTTTCA TCAAGGTACA CGTATACTTA ATAGTGGTTG AAAATACCTC
TTTTATGCAT GATCAATCAC TTGCCTCGTT AATTTTTCAG GTGTATCAAC CTTCGGAGAA AATTTCAGTT AATGAATTCA
ATGGACTGTT ATGTGTTGAA GAGGTAAGCA TTTGCTTATA CGGAAACTTT ATTGAGATGT TCTGTCCTTT AAGCAATCTG
AAGTTCAGGC TACAAAGCAA ATGACCTACA GTTGGGCATG CTTTGTTAAA ATGAGTGGGC TCATCAACAC GTCATCCCCT
GTAATAAGAT GACACAATAA AATGTGGTCA TCTCATGTTG GAATAAATCA TCCATGGAAT AACCCACTCA AACTGAACAT
GTTGTTAATT AGTGTACATA ATTAGCTACC TTTTCTCCAC ATATTCCTTT TCTGTTGGTC AGGTTCCTGA AGAAGAGAAA
AATGCTGGTG TGCGAGACCG TTTGGTTCAT GTCTGTCACT TCATCATAGA AAAACAGGTA TTTATATATT TAGAACCTAA
TGTTTCAATA CTGCTTGTAG TCATTTGGta ctccctctgg tttttaatat acaacacaat tgacttcgtc ctcaaactat
gtccagcaat atttattcaa ttacttagtt aagtcatgtg aagagtaccg cttgatctgt catcaaagta atttaagtgt
gcctcgaatg tttatctatt tgcacagata tttctagaaa agatggataa tcaaatgaat tagagtcaat ggtgtcatat
atttaaGACC AGTTTTGAGG AACATGTCAA TGTTCACGAC ATCATGATTC TGGATATAGT TCAGAGTAAA TCCCATTTCA
GCCTTCTTTG ATCTAAGCGT GATGAAACAG TCATCTCTAA AGTATTAGCT GTCCCACTTG TCACAGTGAT TAAGAACATA
GTAGAAATTA TTGAGGTTTG CTACTTTACA TGGTGGACTG ACTAGTCGTT GTACTTTAGC TTGTTTACAT GGGAAACGTG
TAATGGGAAA TATGGCTTTG GCCTTGGAAG GGTTGAGCGT GAACATGCTC AGTCAATGTT GGAAATATCT ATCCACGTTT
TAACTGTCTT CCTGGATAAG CTCAAACTGT TTGGTACTTT CTTAGGCATT GTCTCGTCAA GAGATGACTG AAGCATTTAT
TGTGTCATTT CATTTCATTG TAAACAACCA GGTCGTTGCA TTTTATCTGT AATAATGGGC CACTATATAG TCCTCCAATG
GACACAACTG AATGCTGCCT AAAGGTGTAA CGTCACTTAC TAAGCTGACC TCAATGATCA GTGCCTCTCA ATTCCTATGC
TGGTTTATGG TTCTATTATG AAGCATCGTT CCATTTGCCT GAGCATGTTC TGTATTTTCT TCAGAGTGCA TCTCTGATTC
TCGCTCCAAT TCTTTGTTTT TTGTGACGTT TGTTTTCTTG CGTGCCATTT GAGAGAAGCA ACGGCGACCT GGGATTTCTC
TTATTGAATC ATTTGTCTCA ATCTTTCCAG CACATTGATT ACTACGGAGA ACCTTTCTTC TTTCTTATCC GTGATGGTGA
GACATTATCA GATATCAAAG TGCGTATTCA GAAGAAACTT CTGGTTTCTG ATGAGCAGTT TGCGAAGGTA ATTATTTCAA
CCTTTCATCT CATACACGAT CGATTTTGTA TTACTTTATT ACTGCTTGTT TACTGTTGGT GAGGCTGGTG CTACAGTGTA
AACCTTTAGT GATCTTTTCA ATTACCTTTT CTGCTGTATC ATATATTGGA TACTATCTGA CGTGAGCTAC TTTGATCAGT
GGAAATTTGC TTATATTGCT CACAATCGCC TGGCTGGTGA ATACTTTCAA GATTCAGATA TCGTATTGAG CCGATTCCAG
GTGGGTTAAA TTCTCTTTTA AGAGTTGAGT CGGATTATTC TCAAATAATT TTTTTCTGCC TTGTTTATTT AATATAGAAA
GATGTTTATG GACCATGGGA ACAATGCCTA GGACTTGAGC ACTCAGACGT CACCCCAAAA AGGTCATGCT TGTCCAATCA
GGTATACGCT TATGACTCCT ACTAACTGAC ATGTGAACAG TGGGCATTTT CTGACAACAA TTTGAATAAA TTACAGAACC
GCAATTCTTT CGATAAGGCT GTGAAGATTT TCAACTAGA

Locus: Os01g0771400

Loading...

Locus: Os01g0771400

Loading...