Os01t0771900-01

Locus

Os01g0771900

Description

Similar to Exo-beta-glucanase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK066300 (DDBJ, Best hit)

Protein Evidence

Q75Z80 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase, family 3, N-terminal (IPR001764)

Glycoside hydrolase, family 3, C-terminal (IPR002772)

Glycoside hydrolase, superfamily (IPR017853)

Full-length cDNA

J013060A09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0771900-01)

RiceXPro (AK066300)

Others

KEGG (Os01t0771900-01)

Transcript

2669 bp

>Os01t0771900-01 Similar to Exo-beta-glucanase.
GGTGCGCGTTAACCACCGGACACCACAGCGAGCAGAGCGCCGCTGTTCTCTTCCGCTTCT
CTCCCTGAGCTCGGCCTCGTGTCACTGACGTCGTGTATGAGAGGAAGGTGGTGAGCTCAG
CAGCTCAGGCTCAGCTCGCAGTAGGGAGCAGACGCCGGCCGCATCGCCCCCCTTCGCGTT
TCGCTGCTCCGAGGTGAAACGGCAATGCATGATTGGTGCTGTGTCAGCCTCAGTCCTTGA
TTATTTCCACAGAGAAAACGCATAATGCGCCTTGTTTCTAGGAAGACCTATCAGGTTAAG
AATTCGGGAGAAATATTTGGAAATTCTCAGGCATGATATGTCCCAAAATTTCTTTGGCAT
GCGTTCTTCTGCTCCTATGGTTTACCTCAACGGGAGATGCAGCATACATGAAGTACCTGG
ATCCAAAGCAACCCACCAACACTAGAATCAAGGACCTTATCAGTAGGATGACTCTTGCAG
AAAAAATTGGCCAAATGACACAGATTGAACGTGGGGTTGCATCTGCAGATGTCATGAAAA
ACTACTTCATAGGTAGTGTATTGAGTGGTGGTGGAAGTGTCCCTGCTCCCCAGGCTACTC
CTGCAGTTTGGGTGAACATGGTAAATGAATTCCAGAAAGGCGCCTTGTCAACACGTCTAG
GAATACCTATGATCTACGGCATTGATGCAGTTCATGGTAATAACAATGTCTACAATGCCA
CCCTATTTCCTCACAACATTGGGCTTGGAGCTACAAGGGATCCTGACCTCGTAAGGAGGA
TCGGCGAAGCAACTGCTCTTGAAGTACGGGCAACAGGCATTCCGTACACCTTTGCTCCAT
GTATTGCAGTTTGTCGAGATCCACGATGGGGCCGATGTTATGAGAGCTACAGTGAAGACC
ACAGGGTAGTCCAGCAGATGACAGACATTATACTTGGTCTACAAGGAGATATCCCAATAA
ATCATACCAAGGGAGTTCCTTATATTGCTGGGAAGGATAAAGTTGCTGCTTGTGCTAAGC
ACTTTGTTGGTGATGGTGGAACTCATAATGGAATCAATGAGAACAACACGATCACTGATG
AACATGGGCTTCTAGGCATTCACATGCCCCCATATTATGACTCTATTATAAAGGGTGTTG
CTACTGTTATGGTTTCCTATTCAAGCTTGAATGGTGTCAAAATGCATGCCAATCATGATC
TGGTTACTGGCTACCTGAAATCCAAATTGCATTTTAGAGGATTTGTGATATCAGATTGGC
TAGGAATAGACAGGATAACGTCACCACCTGATGCAAATTATACTTACTCTGTGCAAGCTG
GAATAAATGCTGGTATTGATATGGTCATGGTGCCATTCAATTACACCCAATACATTGATG
ATGTGACATCTCTTGTTAAGAAGGGTATTATCAATATGAGCAGAATTGATGATGCTGTCA
GGCGTATCCTTCGAGTCAAATTTATAATGGGCCTATTCGAGAACCCTTTAGCTGATCTTA
GCTTCGCAGATCAGCTTGGAAAGAAGGAGCACAGAGATTTGGCTAGAGAAGCCGTCAGGA
AATCACTTGTTCTATTAAAAAACGGCAACTCTCCCAATCAACAATTCCTGCCTCTACCAA
AGAAAGCTAGAAGTATCCTTGTAGCTGGAAGCCATGCTAGCAATTTGGGCTACCAATGTG
GCGGGTGGTCAATTGAATGGATCGGAGGTAGTGGAGATATTACTGTAGGTACAACAATTC
TTGAGGCCATAAAGTCCACTGTCGCTGATTCAACACATGTTGTCTACTCTGAGAACCCTG
ATGAAAGCTTCATGAAAAACAATGACTTCTCATTCGCTATTGTTGTTGTTGGTGAGCGAA
CATATGCTGAAACAACAGGTGATGACCCAGAACTCACCATCCTAGACCCTGGTACAGACA
CAATCCGAACAGTGTGTTCCACAGCTAAGTGTGCAGTGGTTATCATCTCTGGTCGGCCTG
TTGTCATTGAACCATATCTTCCAATGATGGAAGCGCTCGTCGCAGCTTGGCTTCCTGGAA
CAGAAGGTCAGGGTGTTGCGGATGTACTGTTTGGGGACTATGGCTTCACCGGGAAGCTCC
CACGCACTTGGTTCAAGTCTGTTGACCAGCTGCCCATGAATGTTGGTGACCTACACTATG
ATCCACTCTTCCCTTTTGGTTTTGGTTTGACAATAAATTCATCGCAGCCAGGGTTCTCTG
GTGCTGACAGACTGAGAGATAGGAATGGGGGGATGATATACGTTGTGTTGAGTTTGGTAC
TGTCAGTAATACTGATGCATGCTTCGGGCATAGGTATATTTTAACTCGAGTTGCCCTTTC
CTAGTCGTAGTATGGTTCCACATCAAGTGCTCCATGCCTCCATCGTTATACGTTGTATGT
ACTAGCTCTATGGAGATTTTTTGATTGCAAAGATGCATTTATCCCTAAAGCTAGGTGGGT
CAGTGGGTGATAAGCAGATTTGTTCTTTCACGGTTTTACCAAATTATGTGTGGTTATAAT
AGAGCATTTTTATCTAGGGAGGACAAAGTAGATGGATTATGCTCTGCAAATACTGATGGG
CCTACAGCACTTCTTTACTCTCCGTACCATGTGACACTCCACAGAAAGTAAAGGAATATT
AAAATGTGGGTAAGAAATTGATGGGTTTG

CDS

1992 bp

>Os01t0771900-01 Similar to Exo-beta-glucanase.
ATGATATGTCCCAAAATTTCTTTGGCATGCGTTCTTCTGCTCCTATGGTTTACCTCAACG
GGAGATGCAGCATACATGAAGTACCTGGATCCAAAGCAACCCACCAACACTAGAATCAAG
GACCTTATCAGTAGGATGACTCTTGCAGAAAAAATTGGCCAAATGACACAGATTGAACGT
GGGGTTGCATCTGCAGATGTCATGAAAAACTACTTCATAGGTAGTGTATTGAGTGGTGGT
GGAAGTGTCCCTGCTCCCCAGGCTACTCCTGCAGTTTGGGTGAACATGGTAAATGAATTC
CAGAAAGGCGCCTTGTCAACACGTCTAGGAATACCTATGATCTACGGCATTGATGCAGTT
CATGGTAATAACAATGTCTACAATGCCACCCTATTTCCTCACAACATTGGGCTTGGAGCT
ACAAGGGATCCTGACCTCGTAAGGAGGATCGGCGAAGCAACTGCTCTTGAAGTACGGGCA
ACAGGCATTCCGTACACCTTTGCTCCATGTATTGCAGTTTGTCGAGATCCACGATGGGGC
CGATGTTATGAGAGCTACAGTGAAGACCACAGGGTAGTCCAGCAGATGACAGACATTATA
CTTGGTCTACAAGGAGATATCCCAATAAATCATACCAAGGGAGTTCCTTATATTGCTGGG
AAGGATAAAGTTGCTGCTTGTGCTAAGCACTTTGTTGGTGATGGTGGAACTCATAATGGA
ATCAATGAGAACAACACGATCACTGATGAACATGGGCTTCTAGGCATTCACATGCCCCCA
TATTATGACTCTATTATAAAGGGTGTTGCTACTGTTATGGTTTCCTATTCAAGCTTGAAT
GGTGTCAAAATGCATGCCAATCATGATCTGGTTACTGGCTACCTGAAATCCAAATTGCAT
TTTAGAGGATTTGTGATATCAGATTGGCTAGGAATAGACAGGATAACGTCACCACCTGAT
GCAAATTATACTTACTCTGTGCAAGCTGGAATAAATGCTGGTATTGATATGGTCATGGTG
CCATTCAATTACACCCAATACATTGATGATGTGACATCTCTTGTTAAGAAGGGTATTATC
AATATGAGCAGAATTGATGATGCTGTCAGGCGTATCCTTCGAGTCAAATTTATAATGGGC
CTATTCGAGAACCCTTTAGCTGATCTTAGCTTCGCAGATCAGCTTGGAAAGAAGGAGCAC
AGAGATTTGGCTAGAGAAGCCGTCAGGAAATCACTTGTTCTATTAAAAAACGGCAACTCT
CCCAATCAACAATTCCTGCCTCTACCAAAGAAAGCTAGAAGTATCCTTGTAGCTGGAAGC
CATGCTAGCAATTTGGGCTACCAATGTGGCGGGTGGTCAATTGAATGGATCGGAGGTAGT
GGAGATATTACTGTAGGTACAACAATTCTTGAGGCCATAAAGTCCACTGTCGCTGATTCA
ACACATGTTGTCTACTCTGAGAACCCTGATGAAAGCTTCATGAAAAACAATGACTTCTCA
TTCGCTATTGTTGTTGTTGGTGAGCGAACATATGCTGAAACAACAGGTGATGACCCAGAA
CTCACCATCCTAGACCCTGGTACAGACACAATCCGAACAGTGTGTTCCACAGCTAAGTGT
GCAGTGGTTATCATCTCTGGTCGGCCTGTTGTCATTGAACCATATCTTCCAATGATGGAA
GCGCTCGTCGCAGCTTGGCTTCCTGGAACAGAAGGTCAGGGTGTTGCGGATGTACTGTTT
GGGGACTATGGCTTCACCGGGAAGCTCCCACGCACTTGGTTCAAGTCTGTTGACCAGCTG
CCCATGAATGTTGGTGACCTACACTATGATCCACTCTTCCCTTTTGGTTTTGGTTTGACA
ATAAATTCATCGCAGCCAGGGTTCTCTGGTGCTGACAGACTGAGAGATAGGAATGGGGGG
ATGATATACGTTGTGTTGAGTTTGGTACTGTCAGTAATACTGATGCATGCTTCGGGCATA
GGTATATTTTAA

Protein

664 aa

>Os01t0771900-01 Similar to Exo-beta-glucanase.
MICPKISLACVLLLLWFTSTGDAAYMKYLDPKQPTNTRIKDLISRMTLAEKIGQMTQIER
GVASADVMKNYFIGSVLSGGGSVPAPQATPAVWVNMVNEFQKGALSTRLGIPMIYGIDAV
HGNNNVYNATLFPHNIGLGATRDPDLVRRIGEATALEVRATGIPYTFAPCIAVCRDPRWG
RCYESYSEDHRVVQQMTDIILGLQGDIPINHTKGVPYIAGKDKVAACAKHFVGDGGTHNG
INENNTITDEHGLLGIHMPPYYDSIIKGVATVMVSYSSLNGVKMHANHDLVTGYLKSKLH
FRGFVISDWLGIDRITSPPDANYTYSVQAGINAGIDMVMVPFNYTQYIDDVTSLVKKGII
NMSRIDDAVRRILRVKFIMGLFENPLADLSFADQLGKKEHRDLAREAVRKSLVLLKNGNS
PNQQFLPLPKKARSILVAGSHASNLGYQCGGWSIEWIGGSGDITVGTTILEAIKSTVADS
THVVYSENPDESFMKNNDFSFAIVVVGERTYAETTGDDPELTILDPGTDTIRTVCSTAKC
AVVIISGRPVVIEPYLPMMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKSVDQL
PMNVGDLHYDPLFPFGFGLTINSSQPGFSGADRLRDRNGGMIYVVLSLVLSVILMHASGI
GIF*

5'UTR

chr01:32585951..32586143 (- strand) : 193 bp

chr01:32585053..32585143 (- strand) : 91 bp

chr01:32584893..32584940 (- strand) : 48 bp

CDS

chr01:32584673..32584892 (- strand) : 220 bp

chr01:32584235..32584440 (- strand) : 206 bp

chr01:32584063..32584152 (- strand) : 90 bp

chr01:32583767..32583912 (- strand) : 146 bp

chr01:32583259..32583502 (- strand) : 244 bp

chr01:32583074..32583178 (- strand) : 105 bp

chr01:32582657..32582839 (- strand) : 183 bp

chr01:32581935..32582136 (- strand) : 202 bp

chr01:32581296..32581779 (- strand) : 484 bp

chr01:32581061..32581172 (- strand) : 112 bp

3'UTR

chr01:32580716..32581060 (- strand) : 345 bp

FASTA

>Os01t0771900-01 class=Sequence position=chr01:32580716..32586143 (- strand)
GGTGCGCGTT AACCACCGGA CACCACAGCG AGCAGAGCGC CGCTGTTCTC TTCCGCTTCT CTCCCTGAGC TCGGCCTCGT
GTCACTGACG TCGTGTATGA GAGGAAGGTG GTGAGCTCAG CAGCTCAGGC TCAGCTCGCA GTAGGGAGCA GACGCCGGCC
GCATCGCCCC CCTTCGCGTT TCGCTGCTCC GAGGTAAGGG GAGCAAAAAA ACCCCAACTT TACTCTTCTA ACCTCGCTTC
CAAGTTCCAA GCAATCACCA CGGCCGCCGG CCACAGCTGC TGCATGTTGC TCGCCTTCCT AGATCGGTTA ATATTGTACT
AGGAGTGAGA TTTGGGCGGT GTCACTTCTC GCCCTTTTTT TTTTCTACTA TGGATTTGGC GGTGGCCGTG ACAGTCTGTA
GAAGATACTC CGGTTGGCTA TGGGGGAATT CTGTCTTTAA AGACCAAGGG AATGTTTTTG ACATTGATGG TTTTTTGGTC
GCTGGGTCAT GTCCATTGAT CTGTTGAGTT AGTTTATTTG GGGTTTATTT GAGCACAGCG ACGGGTGATG ATGCTAGGAG
TATCAATTTA GCTTTTTTAA TATATTTTGC TGGGAAGTGG GAATTAGTGA TACAGTTCTT CACATGCATG GTCTGAAGGT
CACGATCATT GACCTGCCGA AAACGCCTTT TGTGCCCAGT GTAGTACCTG AGGTACCTCT GTTAGCCTGT TTATTGATGT
TTGGACATGT AAAATGCACT TGTATGGATA GTAGTTCTGA TTTGGGGGTG GGGAGGCTAA AGTGAATGCA AATTCTCAAT
GTACTTACAT CTGTTTTTAA GTGCATTATG GCACATAGAC CTGGAATTGC ACATGTATGG ACAGTAATAG AGAGGCTAAA
ATGAATGCGA TCGCTCCATG TTTTATTTCC CCTCTATGGA AGACCAAGCA TGCAAACAGA ATGCATGATA TGTGACTAAT
ATAAGCTGGA AGAACTAACC GTATTTTTTC TGAATTCAAG GTGAAACGGC AATGCATGAT TGGTGCTGTG TCAGCCTCAG
TCCTTGATTA TTTCCACAGA GAAAACGCAT AATGCGCCTT GTTTCTAGGA AGTTAGTCAG GGCTTAGTCC TAGTTTTGCA
AATTCACATT GAGGCACTTC ATTTCCCGAT CTTCTTTCTT GATTTTAGCT TTCTGCCATG CTACTTTTGT TGATTTTCAC
CAGGACCTAT CAGGTTAAGA ATTCGGGAGA AATATTTGGA AATTCTCAGG CATGATATGT CCCAAAATTT CTTTGGCATG
CGTTCTTCTG CTCCTATGGT TTACCTCAAC GGGAGATGCA GCATACATGA AGTACCTGGA TCCAAAGCAA CCCACCAACA
CTAGAATCAA GGACCTTATC AGTAGGATGA CTCTTGCAGA AAAAATTGGC CAAATGACAC AGATTGAACG TGGGGTTGCA
TCTGCAGATG TCATGAAAAA CTACTTCATA GGTAAGTCCT TTATCAACTC TTACTAAGTA GATCTGTACG TAAGTGAACT
TTATTTGACT GACATGTGGA ATATTTGCTG TCTTGCTTCT GATGAGGTTG TTTGAAATAG AAGAATAATG ATTAGTGAAG
CCTTCTTCTG ACACTATTGA GCTAAAGCTA CCATTATGGC ATTGTCATCT GCAAAGTTGT GGCTATGCGC ACCTCAATTA
TAATTTTTTG TGTTGTTTTC TAGGTAGTGT ATTGAGTGGT GGTGGAAGTG TCCCTGCTCC CCAGGCTACT CCTGCAGTTT
GGGTGAACAT GGTAAATGAA TTCCAGAAAG GCGCCTTGTC AACACGTCTA GGAATACCTA TGATCTACGG CATTGATGCA
GTTCATGGTA ATAACAATGT CTACAATGCC ACCCTATTTC CTCACAACAT TGGGCTTGGA GCTACAAGGC ATGTGTTCTA
ATAATCTATA CTTTCGTGTA TTCATTTTGT TGTGTGAGTG CGTGTCAAAC ATTATCTTTC TTTGTATTAG GGATCCTGAC
CTCGTAAGGA GGATCGGCGA AGCAACTGCT CTTGAAGTAC GGGCAACAGG CATTCCGTAC ACCTTTGCTC CATGTATTGC
AGTAAGCACA CGCACGCTGT AGTATTGTTG CTGTTATGCA TTGGATCTTC AGTGGAGCAT GTTGCAATTG CATGAGTATA
TGGCTATATG TACCATTCTT GATTCATTAA GAGCTTTGTT GACCAAAAAT GCTTCATACA ATTTGGTTCA GGTTTGTCGA
GATCCACGAT GGGGCCGATG TTATGAGAGC TACAGTGAAG ACCACAGGGT AGTCCAGCAG ATGACAGACA TTATACTTGG
TCTACAAGGA GATATCCCAA TAAATCATAC CAAGGGAGTT CCTTATATTG CTGGGAAGTA AGATATTTTT TCTCATTGGT
GCTATAAATG ATATTGTAGA TGTAGGCCAT TGTATGGAGC ATGTGCATGT TGACCTAAAT AAGTAAAGCT TATCGGCCTA
AATGAGCACC TTTTATTAAC AATATACTTT TTACATACAT ACGTATGTAA TAGTTAGTGG CACATCTACA TTGCAAAAGC
TATAGGAAAA TAATCAATGT CAATGTCAAG TTGCAATGTG AAGGTTTTCT GTCTTATGTC TCAGCTTATG GCTTTTAACA
GGGATAAAGT TGCTGCTTGT GCTAAGCACT TTGTTGGTGA TGGTGGAACT CATAATGGAA TCAATGAGAA CAACACGATC
ACTGATGAAC ATGGGCTTCT AGGCATTCAC ATGCCCCCAT ATTATGACTC TATTATAAAG GGTGTTGCTA CTGTTATGGT
TTCCTATTCA AGCTTGAATG GTGTCAAAAT GCATGCCAAT CATGATCTGG TTACTGGCTA CCTGAAATCC AAATTGCATT
TTAGAGTTAG TATTAATAAT AAGCAACTTA TTTAAAATTC CTCTTATGTG ATAAAAAACT GACTCTTCAT GCTCTCTGAT
CGCAGGGATT TGTGATATCA GATTGGCTAG GAATAGACAG GATAACGTCA CCACCTGATG CAAATTATAC TTACTCTGTG
CAAGCTGGAA TAAATGCTGG TATTGATATG GTATGTGAAT TTCTTTCAAG AAGATTAGTT CATATTTTCA TACTAGCTAC
AATAAGCATG GTTTAGTTTA ATTTTAGTCA ACATTCATAT CATGATACTG GAAGTGGAAC TGGTCTTACT ACTTTTTTTT
TGTGGGGGGA AGTCTTAATA CTTATTATAC CAATATTAAG CTGGAAGTTT ATTTCGTTCT TTTTATTCAG AAAAAAAGAA
TACATCATTT CATCTCCATA ACAGGTCATG GTGCCATTCA ATTACACCCA ATACATTGAT GATGTGACAT CTCTTGTTAA
GAAGGGTATT ATCAATATGA GCAGAATTGA TGATGCTGTC AGGCGTATCC TTCGAGTCAA ATTTATAATG GGCCTATTCG
AGAACCCTTT AGCTGATCTT AGCTTCGCAG ATCAGCTTGG AAAGAAGGTT GATAACTACA ACATGCTGTA TACTCCACAg
agtaaatttc acaaaactac aaatactttg gttaaattat cacaaaacca tagatttaaa gtgatgtaac acagaactac
atatttaaca ataaatttat cacacaacta taagtttaag gctaagtatc gcaaaactac agatttaata ataaaattat
tatcacaaaa ctacaaattt tggggtttaa atccttagca ctaatgttat gttggactta taattgtttt aaattttgtg
attaaattat cattaaacct gtagttttgt gataactttg ttactaaatc tgtagttttg tgatattcta ccttaaattt
gtagttttgt gataaattta gtgttaaatc tgtagttttg tgatgtatca agttaaatct gtagttttct gataatttga
tcaaagtatc tgtagtttcg tgaaaattac tctACACAAT TGACAAGTTT GGAAATCATC CAAGTAAATG AGTAACTAAT
TTAACAGGAG CACAGAGATT TGGCTAGAGA AGCCGTCAGG AAATCACTTG TTCTATTAAA AAACGGCAAC TCTCCCAATC
AACAATTCCT GCCTCTACCA AAGAAAGCTA GAAGTATCCT TGTAGCTGGA AGCCATGCTA GCAATTTGGG CTACCAATGT
GGCGGGTGGT CAATTGAATG GATCGGAGGT AGTGGAGATA TTACTGTAGG TATGTGTTTT TTCTATATAT CATATATTCT
TTTCTTTTAA AACGAATAAA TCTACTATTT CAGGTTCTTA TTTGCTAAAT TCAACTATAC TTAAGAAAAG CTATTTTGAT
TTTTTTTCCT TACTGTAATA ATTAAATGCA TTTATTCTGT TCAGGTACAA CAATTCTTGA GGCCATAAAG TCCACTGTCG
CTGATTCAAC ACATGTTGTC TACTCTGAGA ACCCTGATGA AAGCTTCATG AAAAACAATG ACTTCTCATT CGCTATTGTT
GTTGTTGGTG AGCGAACATA TGCTGAAACA ACAGGTGATG ACCCAGAACT CACCATCCTA GACCCTGGTA CAGACACAAT
CCGAACAGTG TGTTCCACAG CTAAGTGTGC AGTGGTTATC ATCTCTGGTC GGCCTGTTGT CATTGAACCA TATCTTCCAA
TGATGGAAGC GCTCGTCGCA GCTTGGCTTC CTGGAACAGA AGGTCAGGGT GTTGCGGATG TACTGTTTGG GGACTATGGC
TTCACCGGGA AGCTCCCACG CACTTGGTTC AAGTCTGTTG ACCAGCTGCC CATGAATGTT GGTGACCTAC ACTATGATCC
ACTCTTCCCT TTTGGTTTTG GTTTGACAAT AAATTCATCG CAGCCAGGGT AAGTAATTTC ATCAATCATC CACACTAATG
CAGCTCAAAA TCTAATCCTA AAAATCTGAA AGGCACACTA GTTCGAATCA ATGCTTTGTG GTTTGACCTT CATATTGTTT
CATGTTTTCA GGTTCTCTGG TGCTGACAGA CTGAGAGATA GGAATGGGGG GATGATATAC GTTGTGTTGA GTTTGGTACT
GTCAGTAATA CTGATGCATG CTTCGGGCAT AGGTATATTT TAACTCGAGT TGCCCTTTCC TAGTCGTAGT ATGGTTCCAC
ATCAAGTGCT CCATGCCTCC ATCGTTATAC GTTGTATGTA CTAGCTCTAT GGAGATTTTT TGATTGCAAA GATGCATTTA
TCCCTAAAGC TAGGTGGGTC AGTGGGTGAT AAGCAGATTT GTTCTTTCAC GGTTTTACCA AATTATGTGT GGTTATAATA
GAGCATTTTT ATCTAGGGAG GACAAAGTAG ATGGATTATG CTCTGCAAAT ACTGATGGGC CTACAGCACT TCTTTACTCT
CCGTACCATG TGACACTCCA CAGAAAGTAA AGGAATATTA AAATGTGGGT AAGAAATTGA TGGGTTTG