Os01t0772150-00

Locus

Os01g0772150

Description

Similar to histone-lysine N-methyltransferase SUVR3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET3, SDG729

Oryzabase Gene Name Synonym(s)

SET protein 3

Transcript Evidence

AK355371 (DDBJ)

Protein Evidence

NP_001151282.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Functional domain (InterPro)

SET domain (IPR001214)

Post-SET domain (IPR003616)

Pre-SET domain (IPR007728)

Expression Databases

TENOR (Os01t0772150-00)

Others

Oryzabase (13372)

KEGG (Os01t0772150-00 (EC:2.1.1.43))

Transcript

1017 bp

>Os01t0772150-00 Similar to histone-lysine N-methyltransferase SUVR3.
ATGAGAAACTCAGCAACGCCCGGCGCCGTCGGCGAGTTGGCCGAGCTGGTCTTGCCGTGG
CTGCCGCCGCAAGACCTCGCCGCTGCGGCCTCCGCCAGCCGCGCCCTGCGTGCGGCCGCT
TCCAGCGTCAGCGCCGGCCGCGCCGCCGACGCGGCGCACGGGCTGGAGCCTCACCCCATC
CCCTTCGACAACCTCGTCGACGGCAAGCCCTACGCCTACTTCCTCTACACCCCCTTCTCC
CTCACCCCGTCCTCCGCCTCCGCCTCACCCCGCCGCGCCCAGCCGTGGGGGCGCACGTGG
GCACGACCGCCAGGCCCCACATGGCCTCGCTCCGACCTAGGCGGGTTCCCCTCGTCCGGG
TGCGCGTGCGCTCAGGGGGCGTGCGGCGGCGCGCGGGGGTGCCCGTGCGCTGACCCGGAG
GCTGAGGCGGTCGGCTTGGGGTCGGAGGCGGGGATGGGGAGCCTCAGGGAGTGCGGCGAC
GGGTGCGCGTGCGGGCCCTCGTGCGGGAACCGGCGGACCCAGCTCGGCGTCACGGTGCGG
CTGCGCGTCGTGCGCCACCGGGAGAAAGGGTGGGGGCTGCACGCCGCCGAGGTCCTTCGC
CGCGGGCAGTTCGTTTGCGAGTATGCTGGTGAGCTTTTGACAACTGAAGAAGCAAGGAGG
CGGCAGGGGCTATATGATGAGCTTGCCTCTGTCGGTAAGCTCTCTCCTGCACTCATTGTC
ATACGGGAGCATCTACCTTCTGGAAAAGCATGCCTAAGAGTTAACATTGATGCAACGAAA
GTGGGGAATGTGGCTCGTTTTATCAATCATTCGTGTGATGGAGGCAACCTGCATCCTGTC
TTAGTTAGGAGCTCAGGCTCATTGCTCCCAAGACTCTGCTTTTTTGCTGCTAGAGATATC
ATCGAAGGAGAAGAGCTCACCTTCAGTTATGGTGATGCTAGACTTAGGCCGAATGGCTTG
CCGTGCTTTTGCGGTAGCTTGTGCTGTTCCGGCCTACTTCCTTCGGAAGAGACATAA

CDS

1017 bp

>Os01t0772150-00 Similar to histone-lysine N-methyltransferase SUVR3.
ATGAGAAACTCAGCAACGCCCGGCGCCGTCGGCGAGTTGGCCGAGCTGGTCTTGCCGTGG
CTGCCGCCGCAAGACCTCGCCGCTGCGGCCTCCGCCAGCCGCGCCCTGCGTGCGGCCGCT
TCCAGCGTCAGCGCCGGCCGCGCCGCCGACGCGGCGCACGGGCTGGAGCCTCACCCCATC
CCCTTCGACAACCTCGTCGACGGCAAGCCCTACGCCTACTTCCTCTACACCCCCTTCTCC
CTCACCCCGTCCTCCGCCTCCGCCTCACCCCGCCGCGCCCAGCCGTGGGGGCGCACGTGG
GCACGACCGCCAGGCCCCACATGGCCTCGCTCCGACCTAGGCGGGTTCCCCTCGTCCGGG
TGCGCGTGCGCTCAGGGGGCGTGCGGCGGCGCGCGGGGGTGCCCGTGCGCTGACCCGGAG
GCTGAGGCGGTCGGCTTGGGGTCGGAGGCGGGGATGGGGAGCCTCAGGGAGTGCGGCGAC
GGGTGCGCGTGCGGGCCCTCGTGCGGGAACCGGCGGACCCAGCTCGGCGTCACGGTGCGG
CTGCGCGTCGTGCGCCACCGGGAGAAAGGGTGGGGGCTGCACGCCGCCGAGGTCCTTCGC
CGCGGGCAGTTCGTTTGCGAGTATGCTGGTGAGCTTTTGACAACTGAAGAAGCAAGGAGG
CGGCAGGGGCTATATGATGAGCTTGCCTCTGTCGGTAAGCTCTCTCCTGCACTCATTGTC
ATACGGGAGCATCTACCTTCTGGAAAAGCATGCCTAAGAGTTAACATTGATGCAACGAAA
GTGGGGAATGTGGCTCGTTTTATCAATCATTCGTGTGATGGAGGCAACCTGCATCCTGTC
TTAGTTAGGAGCTCAGGCTCATTGCTCCCAAGACTCTGCTTTTTTGCTGCTAGAGATATC
ATCGAAGGAGAAGAGCTCACCTTCAGTTATGGTGATGCTAGACTTAGGCCGAATGGCTTG
CCGTGCTTTTGCGGTAGCTTGTGCTGTTCCGGCCTACTTCCTTCGGAAGAGACATAA

Protein

339 aa

>Os01t0772150-00 Similar to histone-lysine N-methyltransferase SUVR3.
MRNSATPGAVGELAELVLPWLPPQDLAAAASASRALRAAASSVSAGRAADAAHGLEPHPI
PFDNLVDGKPYAYFLYTPFSLTPSSASASPRRAQPWGRTWARPPGPTWPRSDLGGFPSSG
CACAQGACGGARGCPCADPEAEAVGLGSEAGMGSLRECGDGCACGPSCGNRRTQLGVTVR
LRVVRHREKGWGLHAAEVLRRGQFVCEYAGELLTTEEARRRQGLYDELASVGKLSPALIV
IREHLPSGKACLRVNIDATKVGNVARFINHSCDGGNLHPVLVRSSGSLLPRLCFFAARDI
IEGEELTFSYGDARLRPNGLPCFCGSLCCSGLLPSEET*

CDS

chr01:32596638..32597265 (- strand) : 628 bp

chr01:32594937..32595325 (- strand) : 389 bp

FASTA

>Os01t0772150-00 class=Sequence position=chr01:32594937..32597265 (- strand)
ATGAGAAACT CAGCAACGCC CGGCGCCGTC GGCGAGTTGG CCGAGCTGGT CTTGCCGTGG CTGCCGCCGC AAGACCTCGC
CGCTGCGGCC TCCGCCAGCC GCGCCCTGCG TGCGGCCGCT TCCAGCGTCA GCGCCGGCCG CGCCGCCGAC GCGGCGCACG
GGCTGGAGCC TCACCCCATC CCCTTCGACA ACCTCGTCGA CGGCAAGCCC TACGCCTACT TCCTCTACAC CCCCTTCTCC
CTCACCCCGT CCTCCGCCTC CGCCTCACCC CGCCGCGCCC AGCCGTGGGG GCGCACGTGG GCACGACCGC CAGGCCCCAC
ATGGCCTCGC TCCGACCTAG GCGGGTTCCC CTCGTCCGGG TGCGCGTGCG CTCAGGGGGC GTGCGGCGGC GCGCGGGGGT
GCCCGTGCGC TGACCCGGAG GCTGAGGCGG TCGGCTTGGG GTCGGAGGCG GGGATGGGGA GCCTCAGGGA GTGCGGCGAC
GGGTGCGCGT GCGGGCCCTC GTGCGGGAAC CGGCGGACCC AGCTCGGCGT CACGGTGCGG CTGCGCGTCG TGCGCCACCG
GGAGAAAGGG TGGGGGCTGC ACGCCGCCGA GGTCCTTCGC CGCGGGCAGT TCGTTTGCGA GTATGCTGGT AATGCAACTC
TTTCCCCTCT ACTCCGTATA AATTATAAAA TGATCTGTAA AATTTATCAC ACCATAAATG CTCCATGCCA AATTTGCCTT
GTTATTGCAC CAGTGAATCG TAATGAGGAA AGCGATGTCA TATGTTAATT CTTTTACCGA AAGTTGTTGA TTTCGTTTCA
TCCTTCTATA TCCATTAGAA ATGGCGGTGT AGAAAGATAT TACAGAAAAT GAATGGTTTG GGAGATGCCT CTGCGTTCCT
ATGCAGCTGG GCTCTGGTTG CATCTCAACA TGGCATAGTA GTGCTATATA TCTCTCTCCT TGTATTTTAG GTGGTTGTGT
TGTTGTGTTG TTGCTATTCG ATCATTTCAA CGCATCAAGG AAATGAGACA ACTCAATAAT TAGTTGCTCA GAGTGCAGCT
CTTTTCTTCT CATATGGATA GCCCATGTTC CATTATTTTC TACAACAAAG ATAGGTTTTA ACATTCCTTT TATACATATA
ATCCTAGTTC TTAGAGGGCA AGCTCTTACT AATGTACCCA GGAATTCATG TCAAGAGCAT TTGCAGTCAG GCATCATAGG
AGATTAAAGA ATCATGCATT TTGGGTGTAA ATGTGGTTGG AAATAGGTAT CAGTATACAT AATTAAGGTT ATAGATTTAG
ACTAAGAAAT ATCAAGTTTC CGGCTTATCG GAACACAATA GTTCAGACAT GCACCGGCAA TACAGCTTTG CAAGAGGTCA
CATGGGGATT TACAATTGCC TTGTCATTAT TTGTGTACTT TGTTGTTAAG AAAACTGTAG TTTGGAAATG AACACCCTGG
GTCATTGAAG ATTGTTGTGA CTGCTCATCA TCTTTATCAC CTTGCCAAAT TCTTATGCGG TTGCCATAGG CTTACTCATG
CTTTCCATCA GTATTCATTA GGATTAAAGT GTCATTCTTT TACTAAAACT GTAATATGCT CATTATTTGT GCTTTACTAG
CATTTGAATT CTTTTCTGGG TAGGGAAGAT TTGCACTGCA AATTGTTTAC ACTGTTTCAG TTGTTCTTAG GTTTGGTTGT
TGTAGGCTTG TAGCAGGAGG ATTGACTATA TCTGGCCATC ATTTCATAGT TATTAACAGG AAAGATGATG CAATGGTTTT
ATGATTTGTA ATAATTGGAT GGGGCTGATT GGACATTATC CTTATGCCAT CTCCGTTTAA ACTCATTTTT TTTTGTGATT
TCCATTTTGC TCTGCTCTAT AATTTGAGTA TTTGACTATT GGAATTGATA TCTAAGCTAT TGTAACTTAC TTTGACTATC
ATGTCTATTT TTTATTATAG GTGAGCTTTT GACAACTGAA GAAGCAAGGA GGCGGCAGGG GCTATATGAT GAGCTTGCCT
CTGTCGGTAA GCTCTCTCCT GCACTCATTG TCATACGGGA GCATCTACCT TCTGGAAAAG CATGCCTAAG AGTTAACATT
GATGCAACGA AAGTGGGGAA TGTGGCTCGT TTTATCAATC ATTCGTGTGA TGGAGGCAAC CTGCATCCTG TCTTAGTTAG
GAGCTCAGGC TCATTGCTCC CAAGACTCTG CTTTTTTGCT GCTAGAGATA TCATCGAAGG AGAAGAGCTC ACCTTCAGTT
ATGGTGATGC TAGACTTAGG CCGAATGGCT TGCCGTGCTT TTGCGGTAGC TTGTGCTGTT CCGGCCTACT TCCTTCGGAA
GAGACATAA

Locus: Os01g0772150

Loading...

Locus: Os01g0772150

Loading...