Os01t0782100-01

Locus

Os01g0782100

Description

Protein with NBS (nucleotide-binding site) and LRR(leucine-rich repeat), Race-specific resistance to blast

RAP-DB Gene Symbol Synonym(s)

PISH, Pi sh, Pish, Pi-sh, Pish(t)

RAP-DB Gene Name Synonym(s)

PYRICULARIA ORYZAE RESISTANCE SH, Pyricularia oryzae resistance-sh, Magnaporthe grisea resistance-sh, Blast resistance sh

CGSNL Gene Symbol

PISH

CGSNL Gene Name

PYRICULARIA ORYZAE RESISTANCE SH

Oryzabase Gene Symbol Synonym(s)

Pi sh, Pish, Pi-sh, Pish(t)

Oryzabase Gene Name Synonym(s)

Pyricularia oryzae resistance-sh, Magnaporthe grisea resistance-sh, Blast resistance sh

Transcript Evidence

NM_001185663

Protein Evidence

Q8LQR6

Literature

PMID: 28493203

PMID: 20707904

DOI: 10.1038/srep04550

Note

Manual Curation

June 13, 2018

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

NB-ARC (IPR002182)

Expression Databases

TENOR (Os01t0782100-00)

Others

Oryzabase (269)

Transcript

4636 bp

>Os01t0782100-01 Protein with NBS (nucleotide-binding site) and LRR(leucine-rich repeat), Race-specific resistance to blast
GGGATCTCCCGCCGTTCGGAGACCTAGGGGAGCAAGGGGGAGACTAGAGAAGGTTGCGCT
CCATGAAGTCATGGTGCACCTTAGGTATCTTGAAAGGTTTTACCAAGCGACCTGGTTATT
GAAGCGTGGAGAAGAGGCTCCAGTGCGGCAGGAGAAAGCAGATGAGTAGAGGTACGATCT
CTTCAGGAGAAAGCAGAGCCCAGCTGCCCAGGTGGTGGGGAGAGATTATCAAATTTTTCG
GTGGTGGTTTGGCACGGGACTCTGCCGCTTCGCTGCCTTCAAGGCTCAAGCTCAGGGTGA
CTGGCGGCATCTGACAGTAGTGCTGTTCCATGGCGGAGGTGGTGTTGGCTGGCTTACGTT
TGGCAGCAACACCAATCTGTGTGAAGCTCCTCTGTAATGCTTCGACGTGCCTTGGCGTGG
ACATGACGCGTGAGCTCCATGAACTGGAGACCATCATCATACCACAGTTCGAGCTGGTGA
TTGAAGCAGCTGAGAAAGGAAACCACAGAGCCAAGCTGGACAGATGGCTCCGGGAGCTCA
AACAAGCCTTCTACAATGCTGAGGACCTTCTGGACGAGCATGAGTACAACATCCTTAAGT
GCAAAGCGAAACACAAGGATTCTCTAGTGAAAGATTCCACCCAGGTTCATGACTCTTCCA
TCAGCAATATTTTGAAGCAGCCTATGCGTGCTGTGTCCAGTAGGATGTCCAATCTGCGCC
CAGAGAACAGAAAGATACTTTGCCAGTTGAATGAACTGAAGACCATGCTGGAGAAAGCCA
AGGAGTTCCGTGAGCTGATTCACTTACCTGCTGGTAATAGTCTTGAGGGTCCCAGTGTAC
CAACAATTGTTGTTCCTGTAGTGACATCGCTATTGCCGCCAAGAGTATTTGGTCGCAACA
TGGATCGCGATCGCATAATACATCTTCTTACTAAGCCAATGGCTACTGTTTCTAGCTCAG
TCGGCTACTCTGGTTTGGCCATTGTTGCACATGGAGGAGCAGGAAAATCCACCTTAGCAC
AATGTGTTTACAATGACAAGAGGGTACAAGAACATTTTGACGTCAGGATATGGGTCTGCA
TCTCACGCAAACTTGATGTTCATCGCCATACACGTGAGATTATCGAGTCAGCAACAAATG
GAGAGTGCCCTCGTGTGGACAATCTTGATACTCTCCAGTGCAGATTGaaggacataatgc
aaaaatcagagaaattcctgcttgtgttggatgacgtctggtttgatgaaTCCGTCAATG
AGAGGGAATGGGACCAGTTGCTTGATCCTCTTGTTTCTCAGCAGGAGGGGAGCAGAGTTT
TGGTGACTTCTAGACGAGATGTACTTCCAGCTGCTCTTCACTGTAAGGATGTTGTTCATT
TGGAAAACATGGAAGATGCCGAGTTCTTGGCTCTATTCAAATACCATGCTTTCTCTGGAA
CAGAAATCAGAAATCCACAGTTGCATGCACGGCTAGAAGAGGTCGCAGAGAAGATTGCTA
AAAGGTTAGGACAATCGCCTTTAGCAGCAAGGACAGTAGGCTCCCAGCTGAGCAGGAATA
AGGATATTGCCATATGGAAAAGTGCTCTAAATATTGAAAACTTAAGTGAGCCCATGAAAG
CTCTGTTGTGGAGTTATAATAAATTAGATTCACGTCTGCAGAGATGTTTTCTGTACTGCA
GCTTATTTCCAAAAGGTCACAAGTATAAAATTGATGAGATGGTTGACCTTTGGGTGGCAG
AGGGGCTAGTTGATTCACGCAACCAGGGGGATAAGAGAATTGAAGATATTGGCAGGGATT
ACTTCAATGAGATGGTGTCAGGATCTTTCTTTCAACCAGTTTCTGAAAGATATATGGGTA
CATGGTACATTATGCATGATCTGCTTCATGATTTGGCAGAGTCACTGACTAAAGAAGACT
GCTTCAGATTAGAAGATGATGGGGTGAAAGAGATACCAGCCACTGTTCGACATCTATCTA
TTTGTGTTGACAGTATGAAATTCCATAAGCAAAAGATCTGCAAGCTACGTTATTTACGCA
CTGTTATCTGCATTGACCCTCTCATGGATGACGGAGATGATATTTTTAATCAGCTATTGA
AGAATCTGAAGAAGCTACGTGTACTACATTTGTCGTTTTACAACAGTAGCAGCTTGCCTG
AATGTATTGGTGAGCTGAAGCACCTTCGATATTTGAGTATCATCAGCACATTGATTTCTG
AACTGCCAAGATCATTGTGTACTCTTTTCCACTTGGAGCTACTTCATTTGAATGACAAGG
TCAAGAATTTGCCGGACAGACTCTGTAATTTAAGAAAGTTACGACGTCTTGAAGCATATG
ATGACAGAAACAGAATGTATAAATTGTATAGAGCAGCTCTCCCTCAAATTCCTTACATAG
GCAAGCTATCTTTGCTGCAAGATATTGATGGATTTTGCGTGCAAAAGCAGAAGGGATATG
AGTTGCGACAACTGAGGGACATGAACAAGCTCGGTGGTAATTTGCGTGTCGTTAATCTTG
AAAATGTAACTGGAAAGGATGAAGCCTCAGAGTCGAAGTTGCATCAGAAAACTCATCTTA
GAGGTTTGCATCTCTCCTGGAATGATGTGGATGACATGGATGTTTCACATTTGGAGATTC
TAGAAGGTTTGAGGCCGCCATCTCAATTGGAGGACCTTACAATCGAAGGTTACAAATCCA
CCATGTACCCAAGCTGGTTACTTGATGGATCCTATTTTGAGAATCTAGAGTCTTTTACGC
TTGCTAATTGCTGTGTGATAGGAAGCCTACCACCCAATACCGAGATCTTTAGGCACTGTA
TGACACTTACCCTTGAGAATGTCCCGAATATGAAGACACTACCTTTTCTTCCAGAAGGTC
TCACAAGCCTATCAATTGAGGGGTGCCCACTGCTTGTGTTCACTACTAATAACGATGAAC
TGGAACACCATGATTATAGGGAGAGCATCACGAGGGCAAACAACCTGGAAACACAACTTG
TTTTGATATGGGAAGCGAATTCCGATTCAGATATTAGGAGCACATTGTCGTCCGAACACT
CATCCATGAAGAAGTTGACGGAATTGATGGATACTGATATGTCGGGAAATCTTCAAACCA
TTGAAAGCGCTTTAGAAATAGAGAGAGATGAAGCCTTGGTTAAAGAAGATATCATCAAAG
TATGGCTCTGTTGCCACGAGGAGAGGATGAGATTCATTTATTCAAGGAAGGCTGGGTTGC
CGTTGGTTCTACCATCTGGACTATGCGTACTCTCTCTTTCCTCCTGTAGTATTACAGATG
GAGCTTTAGCTATTTGCCTTGGTGGGCTTACTTCACTTAGAAATTTGTTCTTAACAGAGA
TTATGACTTTAACTACGCTTCCACCGGAAGAGGTCTTCCAACATTTGGGCAATCTTAGAT
ACTTGGTCATTCGTTCCTGCTGGTGTCTCAGATCATTCGGGGGCTTGCGATCTGCTACCT
CTCTTTCAGAAATAAGATTATTTTCCTGTCCTTCTTTACAGTTGGCACGTGGCGCAGAAT
TTATGCAAATGTCCCTTGAGAAGCTATGTGTATACAACTGTGTGCTTTCAGCTGACTTCT
TCTGCGGTGACTGGCCACATCTGAATAATATTGGGTTATGTGGGTGTAGAAGCTCTGCGT
CCTTGTATGTTGGTGATCTTACCTCCCTCAAATCATTCTCACTATATCATTTGCCAGATT
TATGCGTGCTGGAAGGTTTGTCTTACCTACAGCTTCACCACGTGCATTTGATAGATGTTC
CAAAGCTTACTACCGAGAGCATCTCACAGTTCCGCGTACAGCGTTCGCTCTATATTAGCA
GTTCCGTTATGCTCAACCACATGATCTCCGCTGAAGGTTTCAAAGTTCCAGGGTTTCTCT
CTCTTGAAAGCTGCAAGAAGCCATCCGTTTCATTCGAAGAATCTGCAAATTTCACATCCG
TCAAGTGCCTGAGGTTATGTAATTGTGAAATGAGGTCACTACCAGGAAATATGAAGTGCC
TATCCAGTCTAACGAAACTCGATATCTATGACTGCCCCAACATAACATCTCTACCAGATC
TGCCGTCCTCCCTCCAGCATATATGTATATGGGGTTGTGAGCTTTTGAAGAAGAGCTGCA
GGGCACCTGATGGAGAAAGCTGGCCAAAGATTGCGCATATCCGCTGGAAGGAATTCAGAT
GAATTGTGCTTCAGAATCACTACTACGGAGAAGCGCAAAGACACCCCAAGATTTGCTCTC
TCAGGTAACTTCGTCTCTTCGCCACCTGCTACAAGGTAGAGCGCCTCATGCTCATATAGC
AGTTTCAGCTCTCTCCTGTAGTCCTGTGGTCTGTCCGGTTGTGCTGTCCACTCTGTTCCC
TGCTTCGTCGATTGCCACATTTACGTTTCCCTGCTGCCTTCTACCGACCCACGCCTCCCT
TCATCCGGTCTCTGCCACTGACGGCCCATGATCGTGTCCTTTTGCTTTCACCCCTTAAAT
GGAGTCTTGTTGGTCCAAGAAAATCTCTGTTTGTCTGTTGAACACTCAACTATCTCTCGT
ATTTTGTGTGATATCGCTCGTATTTGATTGCGTGATGTGATAATATATTGAAGTAATTGG
ATTTTGTACTTCGCAC

CDS

3873 bp

>Os01t0782100-01 Protein with NBS (nucleotide-binding site) and LRR(leucine-rich repeat), Race-specific resistance to blast
ATGGCGGAGGTGGTGTTGGCTGGCTTACGTTTGGCAGCAACACCAATCTGTGTGAAGCTC
CTCTGTAATGCTTCGACGTGCCTTGGCGTGGACATGACGCGTGAGCTCCATGAACTGGAG
ACCATCATCATACCACAGTTCGAGCTGGTGATTGAAGCAGCTGAGAAAGGAAACCACAGA
GCCAAGCTGGACAGATGGCTCCGGGAGCTCAAACAAGCCTTCTACAATGCTGAGGACCTT
CTGGACGAGCATGAGTACAACATCCTTAAGTGCAAAGCGAAACACAAGGATTCTCTAGTG
AAAGATTCCACCCAGGTTCATGACTCTTCCATCAGCAATATTTTGAAGCAGCCTATGCGT
GCTGTGTCCAGTAGGATGTCCAATCTGCGCCCAGAGAACAGAAAGATACTTTGCCAGTTG
AATGAACTGAAGACCATGCTGGAGAAAGCCAAGGAGTTCCGTGAGCTGATTCACTTACCT
GCTGGTAATAGTCTTGAGGGTCCCAGTGTACCAACAATTGTTGTTCCTGTAGTGACATCG
CTATTGCCGCCAAGAGTATTTGGTCGCAACATGGATCGCGATCGCATAATACATCTTCTT
ACTAAGCCAATGGCTACTGTTTCTAGCTCAGTCGGCTACTCTGGTTTGGCCATTGTTGCA
CATGGAGGAGCAGGAAAATCCACCTTAGCACAATGTGTTTACAATGACAAGAGGGTACAA
GAACATTTTGACGTCAGGATATGGGTCTGCATCTCACGCAAACTTGATGTTCATCGCCAT
ACACGTGAGATTATCGAGTCAGCAACAAATGGAGAGTGCCCTCGTGTGGACAATCTTGAT
ACTCTCCAGTGCAGATTGaaggacataatgcaaaaatcagagaaattcctgcttgtgttg
gatgacgtctggtttgatgaaTCCGTCAATGAGAGGGAATGGGACCAGTTGCTTGATCCT
CTTGTTTCTCAGCAGGAGGGGAGCAGAGTTTTGGTGACTTCTAGACGAGATGTACTTCCA
GCTGCTCTTCACTGTAAGGATGTTGTTCATTTGGAAAACATGGAAGATGCCGAGTTCTTG
GCTCTATTCAAATACCATGCTTTCTCTGGAACAGAAATCAGAAATCCACAGTTGCATGCA
CGGCTAGAAGAGGTCGCAGAGAAGATTGCTAAAAGGTTAGGACAATCGCCTTTAGCAGCA
AGGACAGTAGGCTCCCAGCTGAGCAGGAATAAGGATATTGCCATATGGAAAAGTGCTCTA
AATATTGAAAACTTAAGTGAGCCCATGAAAGCTCTGTTGTGGAGTTATAATAAATTAGAT
TCACGTCTGCAGAGATGTTTTCTGTACTGCAGCTTATTTCCAAAAGGTCACAAGTATAAA
ATTGATGAGATGGTTGACCTTTGGGTGGCAGAGGGGCTAGTTGATTCACGCAACCAGGGG
GATAAGAGAATTGAAGATATTGGCAGGGATTACTTCAATGAGATGGTGTCAGGATCTTTC
TTTCAACCAGTTTCTGAAAGATATATGGGTACATGGTACATTATGCATGATCTGCTTCAT
GATTTGGCAGAGTCACTGACTAAAGAAGACTGCTTCAGATTAGAAGATGATGGGGTGAAA
GAGATACCAGCCACTGTTCGACATCTATCTATTTGTGTTGACAGTATGAAATTCCATAAG
CAAAAGATCTGCAAGCTACGTTATTTACGCACTGTTATCTGCATTGACCCTCTCATGGAT
GACGGAGATGATATTTTTAATCAGCTATTGAAGAATCTGAAGAAGCTACGTGTACTACAT
TTGTCGTTTTACAACAGTAGCAGCTTGCCTGAATGTATTGGTGAGCTGAAGCACCTTCGA
TATTTGAGTATCATCAGCACATTGATTTCTGAACTGCCAAGATCATTGTGTACTCTTTTC
CACTTGGAGCTACTTCATTTGAATGACAAGGTCAAGAATTTGCCGGACAGACTCTGTAAT
TTAAGAAAGTTACGACGTCTTGAAGCATATGATGACAGAAACAGAATGTATAAATTGTAT
AGAGCAGCTCTCCCTCAAATTCCTTACATAGGCAAGCTATCTTTGCTGCAAGATATTGAT
GGATTTTGCGTGCAAAAGCAGAAGGGATATGAGTTGCGACAACTGAGGGACATGAACAAG
CTCGGTGGTAATTTGCGTGTCGTTAATCTTGAAAATGTAACTGGAAAGGATGAAGCCTCA
GAGTCGAAGTTGCATCAGAAAACTCATCTTAGAGGTTTGCATCTCTCCTGGAATGATGTG
GATGACATGGATGTTTCACATTTGGAGATTCTAGAAGGTTTGAGGCCGCCATCTCAATTG
GAGGACCTTACAATCGAAGGTTACAAATCCACCATGTACCCAAGCTGGTTACTTGATGGA
TCCTATTTTGAGAATCTAGAGTCTTTTACGCTTGCTAATTGCTGTGTGATAGGAAGCCTA
CCACCCAATACCGAGATCTTTAGGCACTGTATGACACTTACCCTTGAGAATGTCCCGAAT
ATGAAGACACTACCTTTTCTTCCAGAAGGTCTCACAAGCCTATCAATTGAGGGGTGCCCA
CTGCTTGTGTTCACTACTAATAACGATGAACTGGAACACCATGATTATAGGGAGAGCATC
ACGAGGGCAAACAACCTGGAAACACAACTTGTTTTGATATGGGAAGCGAATTCCGATTCA
GATATTAGGAGCACATTGTCGTCCGAACACTCATCCATGAAGAAGTTGACGGAATTGATG
GATACTGATATGTCGGGAAATCTTCAAACCATTGAAAGCGCTTTAGAAATAGAGAGAGAT
GAAGCCTTGGTTAAAGAAGATATCATCAAAGTATGGCTCTGTTGCCACGAGGAGAGGATG
AGATTCATTTATTCAAGGAAGGCTGGGTTGCCGTTGGTTCTACCATCTGGACTATGCGTA
CTCTCTCTTTCCTCCTGTAGTATTACAGATGGAGCTTTAGCTATTTGCCTTGGTGGGCTT
ACTTCACTTAGAAATTTGTTCTTAACAGAGATTATGACTTTAACTACGCTTCCACCGGAA
GAGGTCTTCCAACATTTGGGCAATCTTAGATACTTGGTCATTCGTTCCTGCTGGTGTCTC
AGATCATTCGGGGGCTTGCGATCTGCTACCTCTCTTTCAGAAATAAGATTATTTTCCTGT
CCTTCTTTACAGTTGGCACGTGGCGCAGAATTTATGCAAATGTCCCTTGAGAAGCTATGT
GTATACAACTGTGTGCTTTCAGCTGACTTCTTCTGCGGTGACTGGCCACATCTGAATAAT
ATTGGGTTATGTGGGTGTAGAAGCTCTGCGTCCTTGTATGTTGGTGATCTTACCTCCCTC
AAATCATTCTCACTATATCATTTGCCAGATTTATGCGTGCTGGAAGGTTTGTCTTACCTA
CAGCTTCACCACGTGCATTTGATAGATGTTCCAAAGCTTACTACCGAGAGCATCTCACAG
TTCCGCGTACAGCGTTCGCTCTATATTAGCAGTTCCGTTATGCTCAACCACATGATCTCC
GCTGAAGGTTTCAAAGTTCCAGGGTTTCTCTCTCTTGAAAGCTGCAAGAAGCCATCCGTT
TCATTCGAAGAATCTGCAAATTTCACATCCGTCAAGTGCCTGAGGTTATGTAATTGTGAA
ATGAGGTCACTACCAGGAAATATGAAGTGCCTATCCAGTCTAACGAAACTCGATATCTAT
GACTGCCCCAACATAACATCTCTACCAGATCTGCCGTCCTCCCTCCAGCATATATGTATA
TGGGGTTGTGAGCTTTTGAAGAAGAGCTGCAGGGCACCTGATGGAGAAAGCTGGCCAAAG
ATTGCGCATATCCGCTGGAAGGAATTCAGATGA

Protein

1291 aa

>Os01t0782100-01 Protein with NBS (nucleotide-binding site) and LRR(leucine-rich repeat), Race-specific resistance to blast
MAEVVLAGLRLAATPICVKLLCNASTCLGVDMTRELHELETIIIPQFELVIEAAEKGNHR
AKLDRWLRELKQAFYNAEDLLDEHEYNILKCKAKHKDSLVKDSTQVHDSSISNILKQPMR
AVSSRMSNLRPENRKILCQLNELKTMLEKAKEFRELIHLPAGNSLEGPSVPTIVVPVVTS
LLPPRVFGRNMDRDRIIHLLTKPMATVSSSVGYSGLAIVAHGGAGKSTLAQCVYNDKRVQ
EHFDVRIWVCISRKLDVHRHTREIIESATNGECPRVDNLDTLQCRLKDIMQKSEKFLLVL
DDVWFDESVNEREWDQLLDPLVSQQEGSRVLVTSRRDVLPAALHCKDVVHLENMEDAEFL
ALFKYHAFSGTEIRNPQLHARLEEVAEKIAKRLGQSPLAARTVGSQLSRNKDIAIWKSAL
NIENLSEPMKALLWSYNKLDSRLQRCFLYCSLFPKGHKYKIDEMVDLWVAEGLVDSRNQG
DKRIEDIGRDYFNEMVSGSFFQPVSERYMGTWYIMHDLLHDLAESLTKEDCFRLEDDGVK
EIPATVRHLSICVDSMKFHKQKICKLRYLRTVICIDPLMDDGDDIFNQLLKNLKKLRVLH
LSFYNSSSLPECIGELKHLRYLSIISTLISELPRSLCTLFHLELLHLNDKVKNLPDRLCN
LRKLRRLEAYDDRNRMYKLYRAALPQIPYIGKLSLLQDIDGFCVQKQKGYELRQLRDMNK
LGGNLRVVNLENVTGKDEASESKLHQKTHLRGLHLSWNDVDDMDVSHLEILEGLRPPSQL
EDLTIEGYKSTMYPSWLLDGSYFENLESFTLANCCVIGSLPPNTEIFRHCMTLTLENVPN
MKTLPFLPEGLTSLSIEGCPLLVFTTNNDELEHHDYRESITRANNLETQLVLIWEANSDS
DIRSTLSSEHSSMKKLTELMDTDMSGNLQTIESALEIERDEALVKEDIIKVWLCCHEERM
RFIYSRKAGLPLVLPSGLCVLSLSSCSITDGALAICLGGLTSLRNLFLTEIMTLTTLPPE
EVFQHLGNLRYLVIRSCWCLRSFGGLRSATSLSEIRLFSCPSLQLARGAEFMQMSLEKLC
VYNCVLSADFFCGDWPHLNNIGLCGCRSSASLYVGDLTSLKSFSLYHLPDLCVLEGLSYL
QLHHVHLIDVPKLTTESISQFRVQRSLYISSSVMLNHMISAEGFKVPGFLSLESCKKPSV
SFEESANFTSVKCLRLCNCEMRSLPGNMKCLSSLTKLDIYDCPNITSLPDLPSSLQHICI
WGCELLKKSCRAPDGESWPKIAHIRWKEFR*

5'UTR

chr01:33136846..33137162 (+ strand) : 317 bp

chr01:33141115..33141126 (+ strand) : 12 bp

CDS

chr01:33141127..33144999 (+ strand) : 3873 bp

3'UTR

chr01:33145000..33145037 (+ strand) : 38 bp

chr01:33145146..33145541 (+ strand) : 396 bp

FASTA

>Os01t0782100-01 class=Sequence position=chr01:33136846..33145541 (+ strand)
GGGATCTCCC GCCGTTCGGA GACCTAGGGG AGCAAGGGGG AGACTAGAGA AGGTTGCGCT CCATGAAGTC ATGGTGCACC
TTAGGTATCT TGAAAGGTTT TACCAAGCGA CCTGGTTATT GAAGCGTGGA GAAGAGGCTC CAGTGCGGCA GGAGAAAGCA
GATGAGTAGA GGTACGATCT CTTCAGGAGA AAGCAGAGCC CAGCTGCCCA GGTGGTGGGG AGAGATTATC AAATTTTTCG
GTGGTGGTTT GGCACGGGAC TCTGCCGCTT CGCTGCCTTC AAGGCTCAAG CTCAGGGTGA CTGGCGGCAT CTGACAGGTT
CATTTCCTCT TGCTTATGTC TTTTAGTTGC AAATCAATTA CCATTGGTTG TGGGTTTGAA TTATTGGGCG AAATGCTCAT
GCGTTGGTCT TGAAATTTAG CTTTTTATCT ATCTCTATgt tttacattat aagtcgcttt aatttttttc taattatttt
tttaagtttg atcaagttca tataaaaatg caacaacatt ttcaactcaa aacaaatata ttaatataat atattcaatg
ctatatgtaa tgaaactaat ttagtgttat gaatgttact atattttttt ataaagttgg ttaaatctaa aaaggtttaa
ttaaaaaaaa tcaaaactac ttataataCA AGTAAAATAG AGAGAATTGC ATAGAAGTGG AAGTGTGTCG GTGTCTGTAC
TGGTTCTACT CACCTAGTCA CCTCCCTGCC ACTGCTATTC TGCTAATAGT GTTAGAGAAT ACGCACGCAC AGATAATGGC
AAGGACGTCA TTTAGAAGAG CCCACTAGTG CGTGTCATGT TGCTTATGTG CAAATTTTAT ACACTTTCTT GACTGACCAA
AGGTTGTATG CGGTCATTTT TTTTTTCTCT CGGTGCTAGC TTTAATATAC GGAAAGCCGT TTAGAGAAGA TGGCATGACA
ATAATGGAGC ATATATATAT AAACTAGCTC GTACCCTGCG GCGTTGCTGC GGGTAGATAT TGTAATTGCA AGTGTCCAGA
GAATAACAAA TAAAATTTTC CATGGAACAA TCATGATGGC CAAATTGTAT AATATATGGC TGAAAGTTCA CATTATCTAA
AACAAATATT TTTCGCTGCG GTCGGAGTGT ATATTAAGAA GGAGAGAGTT TAAGCAAACT GTACAAGAGA ACAATCAGAG
CCAAAGCTCA CATACAGAAC CAGGACACTG GTTCGCCACA CACACATGGT TCAAACTTCA AACATTACTG GGAGTCTGAT
ATACATTTCT TTCTTGTCTT CCTGCAAATT TGTGTTGGCA CTAGCTTCAT ACAGACCTCA ACTCTACTGA TCCAAGAACA
ACATGTAGGG CTACATCCTA CATGTATACC CAAATACCCA ATACAAACAC AAAATAGACG AAGCTACCCT GCAATGCAAT
CAGTAATAAG ATCAATAGTT GATACCGAAG CCACCAGCCA GCATTTCGGG TAAACATAGA GCAACAATGA ATATAAGCAA
GTCTCTTAAG AATTACGTTC TCATTTTGAT AAACTGGCAA GCACGGGTGA ATTTTGCATC AACACCCAAC GGAAATTTGA
TTAGCATTCC TTGAAATATG TCACTGTTGA TGAAGGTAAA AAAGTAAACA CAAAGTGAAG CCCATAGAGC TTCAGTTTAG
TTCAGGCATC AACATAGTTT AACTCATGAA CCTCCAAATT AAATAAATTA TTTATTTCAT TATTATATAT CATACCTTGG
TACATTTGTC AGCCTCACGG CAGTAGATTT TGCCCATGTT GCAGTAAGTT ACACACACAA ACACCAAATA TGCTAGTTTT
TAAACTATTC TTGTTTCACT AGATTTAATT GCATTTGGTT TTTTACTATG CTATTTCGGA GTTGTTTAAT TTGATAGTGG
GGGCCATAGA GTATAATGAA AAACAGCAAG GTAATGAGAA CCAGAGCATA GTCCGGCTAG AATATTTTAG GAGTCCTTTT
AATGAGGTCC AGCTtgttaa gggtagtatg tctaggggta ttttagatat ttcccatctc tctcttgtac aaatatattt
tgccctttgg gcctaatcta attggaacag ttcattctcc aatttctcca aattgtaaca tggtatcaga cccttgttcc
aaaaacccta gccaccaaat ccgatcatca ccggcgcacc ggcggcggtg agccgccggc gagccatcat catcgtcctc
cttcatccct caacgttttt gtctccaagc agcaagcctg cagttcgtcg tcgtcaccgt gttcctgttc gccggtcgca
gccgccgcca gttgcggcgc cgcgcccgtt cccacttctc cacccacgca gccacgccgt cgtggtgttc atccacgctg
ctcgtcGCGG GGCTCGTTCT TGCCGCCGTT CGAGAGCCGC CGCTGTGGCC TCGTCAATCT ACATCAAGGC ATCAAGCAAC
ATCAGTTTTT GGCCCATTTC TTGTCAGTTA GCATCAGCAA ACCATCGTCC TCTCTGATCT GCAGCAGCAA CAACAACAAC
TCCCGTTCAC CTCCTAGTAG ATGCAGCAGC TAGCCCATTG TTGTCTCCTA ATTTCAGCAG TAGAATTTCC ATGTTCCATT
GTTTGTGTTG CAACATGCAT TCTGCAGATT GTCATCAAGC TTGTATTCCA CCACATGTGT TAGTCAGTTT TTGCGCTTGC
TAATCGCTGC CATCCACTAC TCACTCATCA ATCATCACCA TGCTTTGTTA TTGTTAGCTA CTTATTATAA TCCAATTTTA
CTTCTCCAAA TTATCATGAT GGCTTGTAGT AGTCACTGGT TAGGTCATTA GCTGCTTGCT TGCTACTGTC AACATGTTCA
CTAGCATCCT TTGTGTCTTT TGCTAGTAAT GTGCATCTCT GCTTGCAGTC CATCTATCAA TATTGCCTTT TTGCTATATC
CATCAATCCG TGTTCTTTAC TAAtcaaatt cctgtgtttc ctaccgagtc cagcaaaatc cattgcatat ccttcatttt
gtcgaagctg tgccagtcca tctcttCAtg gtcatttcat catcaccagc tccccgtcgg agctggcctt cattgtcact
tcatatcttc atcatctcca tgtcggagct tgtcatcatc atcatcaatc agtgaaggtc cgaagaacag tttgtgaagg
gccttcatca atatcaatgt ctcatcatca atcaaaggac cgaagaacag cttgtgaagg tccattgtca tcatcatcaa
catctccgaa tcaatgaaga gccgaagaac gattcgtgaa ggcttcaagg taccgagggc cgaagaacag tttgtgaagg
ctccgaggtc catttcattg aggagggggt cttttcttct tcatcatcca agaattgaca cacttcgacg acatcatcaa
gactttggag ataggctaat atttagattg tgttctcatg tttagtttac ctttcaaatg caatgttatt acatacacat
tgcatttgag tgggggtgtt aagggtagta tgtctagggg tattttagat atttcccatc tctctcttgt acaaatatat
tttgcccttt gggcctaatc taattggaac agttcattcc ccaatttctc caaattGTGA CACAGCTCAT CTGAATATTA
GAGAAATATA AATTTGCCAC TAACATTTAA CAATGTCCCA CTTGTCtact ccctccgtca aaaaaaacca aacctaagac
ttagatgtga tataatctag tatctgtcta gattcgttgt actagattat ggcttaaata ctagattaag ttttttttgg
gacggaggga gtaTGTCTAA CCAAAATAAC ACAATTGATT TGCATATTGT GTTTTGCCTC GCATTGTGCC GAAGCAATCT
TATCTGTGGC AATTGGTAGA GTTCTTCCTC TCACACCTTC TCTGCAATAC AAACGCATCT GGCTCTGGTA ACCTTGCACT
CCTCTCTTAG TATTTCTTTC CTTCACGCTT TCTTGTCTCT GCTTAAGTTC TCTATCGTTT GGTACCATCA TGCATTAATT
CCTTTTTCCT CTATTTCCCA CTCCAAACAT TTCCATAACC ACTCACATAC ACAAAAATAA AAAACCAGAC AGAGAGAAAA
AAACTTGTTT TGGGAGTTCT GTTGTTATCT TCCTCACAGA AGAAAAATCT CTCCATCACC ATCTGTTCTT ATGCCCTGCT
TCTATTCATT CACTTGTTCA CAGCTGCAGT AGTGCTGTTC CATGGCGGAG GTGGTGTTGG CTGGCTTACG TTTGGCAGCA
ACACCAATCT GTGTGAAGCT CCTCTGTAAT GCTTCGACGT GCCTTGGCGT GGACATGACG CGTGAGCTCC ATGAACTGGA
GACCATCATC ATACCACAGT TCGAGCTGGT GATTGAAGCA GCTGAGAAAG GAAACCACAG AGCCAAGCTG GACAGATGGC
TCCGGGAGCT CAAACAAGCC TTCTACAATG CTGAGGACCT TCTGGACGAG CATGAGTACA ACATCCTTAA GTGCAAAGCG
AAACACAAGG ATTCTCTAGT GAAAGATTCC ACCCAGGTTC ATGACTCTTC CATCAGCAAT ATTTTGAAGC AGCCTATGCG
TGCTGTGTCC AGTAGGATGT CCAATCTGCG CCCAGAGAAC AGAAAGATAC TTTGCCAGTT GAATGAACTG AAGACCATGC
TGGAGAAAGC CAAGGAGTTC CGTGAGCTGA TTCACTTACC TGCTGGTAAT AGTCTTGAGG GTCCCAGTGT ACCAACAATT
GTTGTTCCTG TAGTGACATC GCTATTGCCG CCAAGAGTAT TTGGTCGCAA CATGGATCGC GATCGCATAA TACATCTTCT
TACTAAGCCA ATGGCTACTG TTTCTAGCTC AGTCGGCTAC TCTGGTTTGG CCATTGTTGC ACATGGAGGA GCAGGAAAAT
CCACCTTAGC ACAATGTGTT TACAATGACA AGAGGGTACA AGAACATTTT GACGTCAGGA TATGGGTCTG CATCTCACGC
AAACTTGATG TTCATCGCCA TACACGTGAG ATTATCGAGT CAGCAACAAA TGGAGAGTGC CCTCGTGTGG ACAATCTTGA
TACTCTCCAG TGCAGATTGa aggacataat gcaaaaatca gagaaattcc tgcttgtgtt ggatgacgtc tggtttgatg
aaTCCGTCAA TGAGAGGGAA TGGGACCAGT TGCTTGATCC TCTTGTTTCT CAGCAGGAGG GGAGCAGAGT TTTGGTGACT
TCTAGACGAG ATGTACTTCC AGCTGCTCTT CACTGTAAGG ATGTTGTTCA TTTGGAAAAC ATGGAAGATG CCGAGTTCTT
GGCTCTATTC AAATACCATG CTTTCTCTGG AACAGAAATC AGAAATCCAC AGTTGCATGC ACGGCTAGAA GAGGTCGCAG
AGAAGATTGC TAAAAGGTTA GGACAATCGC CTTTAGCAGC AAGGACAGTA GGCTCCCAGC TGAGCAGGAA TAAGGATATT
GCCATATGGA AAAGTGCTCT AAATATTGAA AACTTAAGTG AGCCCATGAA AGCTCTGTTG TGGAGTTATA ATAAATTAGA
TTCACGTCTG CAGAGATGTT TTCTGTACTG CAGCTTATTT CCAAAAGGTC ACAAGTATAA AATTGATGAG ATGGTTGACC
TTTGGGTGGC AGAGGGGCTA GTTGATTCAC GCAACCAGGG GGATAAGAGA ATTGAAGATA TTGGCAGGGA TTACTTCAAT
GAGATGGTGT CAGGATCTTT CTTTCAACCA GTTTCTGAAA GATATATGGG TACATGGTAC ATTATGCATG ATCTGCTTCA
TGATTTGGCA GAGTCACTGA CTAAAGAAGA CTGCTTCAGA TTAGAAGATG ATGGGGTGAA AGAGATACCA GCCACTGTTC
GACATCTATC TATTTGTGTT GACAGTATGA AATTCCATAA GCAAAAGATC TGCAAGCTAC GTTATTTACG CACTGTTATC
TGCATTGACC CTCTCATGGA TGACGGAGAT GATATTTTTA ATCAGCTATT GAAGAATCTG AAGAAGCTAC GTGTACTACA
TTTGTCGTTT TACAACAGTA GCAGCTTGCC TGAATGTATT GGTGAGCTGA AGCACCTTCG ATATTTGAGT ATCATCAGCA
CATTGATTTC TGAACTGCCA AGATCATTGT GTACTCTTTT CCACTTGGAG CTACTTCATT TGAATGACAA GGTCAAGAAT
TTGCCGGACA GACTCTGTAA TTTAAGAAAG TTACGACGTC TTGAAGCATA TGATGACAGA AACAGAATGT ATAAATTGTA
TAGAGCAGCT CTCCCTCAAA TTCCTTACAT AGGCAAGCTA TCTTTGCTGC AAGATATTGA TGGATTTTGC GTGCAAAAGC
AGAAGGGATA TGAGTTGCGA CAACTGAGGG ACATGAACAA GCTCGGTGGT AATTTGCGTG TCGTTAATCT TGAAAATGTA
ACTGGAAAGG ATGAAGCCTC AGAGTCGAAG TTGCATCAGA AAACTCATCT TAGAGGTTTG CATCTCTCCT GGAATGATGT
GGATGACATG GATGTTTCAC ATTTGGAGAT TCTAGAAGGT TTGAGGCCGC CATCTCAATT GGAGGACCTT ACAATCGAAG
GTTACAAATC CACCATGTAC CCAAGCTGGT TACTTGATGG ATCCTATTTT GAGAATCTAG AGTCTTTTAC GCTTGCTAAT
TGCTGTGTGA TAGGAAGCCT ACCACCCAAT ACCGAGATCT TTAGGCACTG TATGACACTT ACCCTTGAGA ATGTCCCGAA
TATGAAGACA CTACCTTTTC TTCCAGAAGG TCTCACAAGC CTATCAATTG AGGGGTGCCC ACTGCTTGTG TTCACTACTA
ATAACGATGA ACTGGAACAC CATGATTATA GGGAGAGCAT CACGAGGGCA AACAACCTGG AAACACAACT TGTTTTGATA
TGGGAAGCGA ATTCCGATTC AGATATTAGG AGCACATTGT CGTCCGAACA CTCATCCATG AAGAAGTTGA CGGAATTGAT
GGATACTGAT ATGTCGGGAA ATCTTCAAAC CATTGAAAGC GCTTTAGAAA TAGAGAGAGA TGAAGCCTTG GTTAAAGAAG
ATATCATCAA AGTATGGCTC TGTTGCCACG AGGAGAGGAT GAGATTCATT TATTCAAGGA AGGCTGGGTT GCCGTTGGTT
CTACCATCTG GACTATGCGT ACTCTCTCTT TCCTCCTGTA GTATTACAGA TGGAGCTTTA GCTATTTGCC TTGGTGGGCT
TACTTCACTT AGAAATTTGT TCTTAACAGA GATTATGACT TTAACTACGC TTCCACCGGA AGAGGTCTTC CAACATTTGG
GCAATCTTAG ATACTTGGTC ATTCGTTCCT GCTGGTGTCT CAGATCATTC GGGGGCTTGC GATCTGCTAC CTCTCTTTCA
GAAATAAGAT TATTTTCCTG TCCTTCTTTA CAGTTGGCAC GTGGCGCAGA ATTTATGCAA ATGTCCCTTG AGAAGCTATG
TGTATACAAC TGTGTGCTTT CAGCTGACTT CTTCTGCGGT GACTGGCCAC ATCTGAATAA TATTGGGTTA TGTGGGTGTA
GAAGCTCTGC GTCCTTGTAT GTTGGTGATC TTACCTCCCT CAAATCATTC TCACTATATC ATTTGCCAGA TTTATGCGTG
CTGGAAGGTT TGTCTTACCT ACAGCTTCAC CACGTGCATT TGATAGATGT TCCAAAGCTT ACTACCGAGA GCATCTCACA
GTTCCGCGTA CAGCGTTCGC TCTATATTAG CAGTTCCGTT ATGCTCAACC ACATGATCTC CGCTGAAGGT TTCAAAGTTC
CAGGGTTTCT CTCTCTTGAA AGCTGCAAGA AGCCATCCGT TTCATTCGAA GAATCTGCAA ATTTCACATC CGTCAAGTGC
CTGAGGTTAT GTAATTGTGA AATGAGGTCA CTACCAGGAA ATATGAAGTG CCTATCCAGT CTAACGAAAC TCGATATCTA
TGACTGCCCC AACATAACAT CTCTACCAGA TCTGCCGTCC TCCCTCCAGC ATATATGTAT ATGGGGTTGT GAGCTTTTGA
AGAAGAGCTG CAGGGCACCT GATGGAGAAA GCTGGCCAAA GATTGCGCAT ATCCGCTGGA AGGAATTCAG ATGAATTGTG
CTTCAGAATC ACTACTACGG AGAAGCGCAA AGGTGAAGGT CCCATCAATG CATTATCAGA AGTACTCTAT GTAATATTTA
TTTCATTCGC TCATGATCTT ACGAACACAT CATTAACTTC ACGTTTCCTT TGTTTTGCAG ACACCCCAAG ATTTGCTCTC
TCAGGTAACT TCGTCTCTTC GCCACCTGCT ACAAGGTAGA GCGCCTCATG CTCATATAGC AGTTTCAGCT CTCTCCTGTA
GTCCTGTGGT CTGTCCGGTT GTGCTGTCCA CTCTGTTCCC TGCTTCGTCG ATTGCCACAT TTACGTTTCC CTGCTGCCTT
CTACCGACCC ACGCCTCCCT TCATCCGGTC TCTGCCACTG ACGGCCCATG ATCGTGTCCT TTTGCTTTCA CCCCTTAAAT
GGAGTCTTGT TGGTCCAAGA AAATCTCTGT TTGTCTGTTG AACACTCAAC TATCTCTCGT ATTTTGTGTG ATATCGCTCG
TATTTGATTG CGTGATGTGA TAATATATTG AAGTAATTGG ATTTTGTACT TCGCAC