Os01t0795000-01

Locus

Os01g0795000

Description

Subtilase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

RSP1, OsSub5, SUB5, OsSub6, SUB6

Oryzabase Gene Name Synonym(s)

subtilase, subtilisin-like serine protease 1, Subtilisin 5, SUBTILISIN 5, Subtilisin 6, SUBTILISIN 6

Transcript Evidence

AK243517 (DDBJ, Best hit)

Protein Evidence

Q9FVC7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Biological Process: negative regulation of catalytic activity (GO:0043086)

Molecular Function: serine-type endopeptidase activity (GO:0004252)

Molecular Function: identical protein binding (GO:0042802)

Functional domain (InterPro)

Peptidase S8/S53, subtilisin/kexin/sedolisin (IPR000209)

Protease-associated domain, PA (IPR003137)

Proteinase inhibitor I9, subtilisin propeptide (IPR010259)

Peptidase S8, subtilisin-related (IPR015500)

Peptidase S8, subtilisin, Ser-active site (IPR023828)

Full-length cDNA

J100075F14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0795000-01)

Others

Oryzabase (13859)

KEGG (Os01t0795000-01)

Transcript

2390 bp

>Os01t0795000-01 Subtilase.
ACCTAAAGAAAATAAAAATGGAAGTCCATTCTTGTCAGCACCGTTTGGTTTCATTGCTGC
TACTTTGTTTTTGGATGCTGTTCATCAGAGCGCATGGATCACGCAAGCTGTACATAGCGT
ATCTCGGTGACAGAAAGCATGCACGCCCAGACGACGTTGTTGCTTCTCACCATGATACGC
TCTCGAGTGTTCTTGGAAGTAAAGACGAATCCTTATCTTCCATCATCTATAACTACAAGC
ATGGGTTCTCAGGCTTTGCTGCCATGCTGACAGCTGAGCAGGCAGAACAGCTTGCAGAGT
TACCAGAAGTCATCAGCGTTCAGCGAAGCAGGAGGTACAGGACGGCGACCACACGGAGCT
GGGACTTCCTGGGGCTGGATTACCAAAAGCCCAGTGAATTACTCAGAAGGAGCAACCACG
GACAAGAGATAATCATCGGGATTATTGACACCGGGATATGGCCGGAGTCAAGAAGTTTCA
GCGACGAAGGATACGGGCCGGTGCCGGCACGGTGGAAGGGCGTGTGCCAGGTCGGAGAAG
GATGGGGCAGCAACAACTGCAGCCGCAAGATCATCGGCGCGCGGTTCTACCACGCCGGGG
TGGACGAGGACGACCTCAAGATCGACTACCTCTCGCCCCGCGACGCGAACGGCCACGGCA
CGCACACGGCGTCCACCGCGGCGGGCTCCGTCGTGGAGGCGGTCAGCTTCCACGGGCTGG
CCGCGGGCACCGCCCGCGGCGGCGCGCCCCGGGCGCGCATCGCGGTGTACAAGTCCGTCT
GGGGCAGGGGCGGCGCCGGGTCAGGGAACTCCGCCACCGTGCTCGCCGCCATCGACGACG
CCATGCACGACGGCGTGGACGTGCTATCCCTGTCCCTCGAGGTTCAGGAGAACTCGTTCG
GCGCGCTGCACGCCGTCCAGAAGGGGATCACCGTCGTGTACGCCGCAGGGAACTCTGGAC
CTGTGCCGCAGGTGGTTGGGAACACGGCTCCATGGGTCATCACAGTCGCAGCAAGCAAGA
TCGATCGGTCTTTCCCGACCGTGATCACTCTGGGGGACAAGACTCAGATAGTGGGACAGT
CCATGTACAGCGAAGGGAAGAACTCATCAGGAAGCACCTTCAAACTTCTAGTAGATGGAG
GCCTATGCACCGATAATGATCTGAACGGCACGGACATAAAGGGAAGAGTTGTGCTGTGCA
CCTCCCTCGGGATACCACCGCTTATGCTTTTCCCGGTAGCATTGAAAAACGTCTTGGATG
CTGGGGGTTCAGGTCTAATCTTCGCTCAATACACAACTGACATCCTGGACGTCACAAAAA
ACTGCAACGGCACTGCCTGTGTTCTTGTGGACCTTGACACTGCACAACTGATCAGCTCAT
ACATCAGCGGCACAAGCTCACCAGTGGCAAAGATCGAACCACCACGCACTGTCACGGGTG
AAGGGATACTGGCACCAAAAGTGGCAGCATTCTCCTCGAGAGGTCCATCAGTTGATTACC
CTGATATTATTAAGCCTGATGTAGCTGCACCAGGATCCAACATTTTAGCAGCCGTGAAAG
ACGGATACAAACTTGAGTCAGGAACATCAATGGCAACGCCACATGTTGCAGGCATTGTTG
CGCTGCTGAAAGCTCTCCATCCAGACTGGTCTCCAGCTGCAATAAAATCGGCAGTTGTTA
CTACTGCGTCTGTAACTGATGAACGAGGCATGCCAATACTGGCAGAAGGAGTGCCTCGGA
AGATCGCTGATCCGTTTGACTACGGAAGTGGAAACATTAACCCAAACAGGGCAGCTGATC
CTGGCCTCATTTATGACATCGACCCAACAGATTACAACAAGTTCTTTGCGTGCACCATCA
AGACATCTGCCAGCTGCAATGCAACAATGCTACCTAGGTATCACCTGAACCTACCATCAA
TCGCTGTTCCTGATCTCAGGGATCCAACAACTGTATCTAGAACAGTTAGAAATGTAGGTG
AGGTTAATGCAGTTTACCACGCTGAAATCCAGTGCCCACCTGGAGTTAAAATGGTTGTTG
AGCCATCTGTTCTTGTCTTCGATGCTGCAAACAAAGTTCACACCTTCAAGGTTAGTTTTT
CACCTCTATGGAAATTGCAAGGGGACTATACATTTGGCAGCCTTACTTGGCACAATGACA
ACAAGTCAGTGAGAATTCCAATAGCAGTCCAGATCACCATCCAAGATTTCTATGCAGATG
TTGCATAACCTGGGCAAAACATGCAGGCAATAACACAGTGCTCTTAGAGGCAATAGAGCA
AAATACAGGATATACCAATTTCCACAGAGATATGGTTGCTTGTAAATACTTATCACCAGA
ATAATGAGTTAATGACCGGCCAATGTTGACTGGTCAATGTATTTCATTTC

CDS

2211 bp

>Os01t0795000-01 Subtilase.
ATGGAAGTCCATTCTTGTCAGCACCGTTTGGTTTCATTGCTGCTACTTTGTTTTTGGATG
CTGTTCATCAGAGCGCATGGATCACGCAAGCTGTACATAGCGTATCTCGGTGACAGAAAG
CATGCACGCCCAGACGACGTTGTTGCTTCTCACCATGATACGCTCTCGAGTGTTCTTGGA
AGTAAAGACGAATCCTTATCTTCCATCATCTATAACTACAAGCATGGGTTCTCAGGCTTT
GCTGCCATGCTGACAGCTGAGCAGGCAGAACAGCTTGCAGAGTTACCAGAAGTCATCAGC
GTTCAGCGAAGCAGGAGGTACAGGACGGCGACCACACGGAGCTGGGACTTCCTGGGGCTG
GATTACCAAAAGCCCAGTGAATTACTCAGAAGGAGCAACCACGGACAAGAGATAATCATC
GGGATTATTGACACCGGGATATGGCCGGAGTCAAGAAGTTTCAGCGACGAAGGATACGGG
CCGGTGCCGGCACGGTGGAAGGGCGTGTGCCAGGTCGGAGAAGGATGGGGCAGCAACAAC
TGCAGCCGCAAGATCATCGGCGCGCGGTTCTACCACGCCGGGGTGGACGAGGACGACCTC
AAGATCGACTACCTCTCGCCCCGCGACGCGAACGGCCACGGCACGCACACGGCGTCCACC
GCGGCGGGCTCCGTCGTGGAGGCGGTCAGCTTCCACGGGCTGGCCGCGGGCACCGCCCGC
GGCGGCGCGCCCCGGGCGCGCATCGCGGTGTACAAGTCCGTCTGGGGCAGGGGCGGCGCC
GGGTCAGGGAACTCCGCCACCGTGCTCGCCGCCATCGACGACGCCATGCACGACGGCGTG
GACGTGCTATCCCTGTCCCTCGAGGTTCAGGAGAACTCGTTCGGCGCGCTGCACGCCGTC
CAGAAGGGGATCACCGTCGTGTACGCCGCAGGGAACTCTGGACCTGTGCCGCAGGTGGTT
GGGAACACGGCTCCATGGGTCATCACAGTCGCAGCAAGCAAGATCGATCGGTCTTTCCCG
ACCGTGATCACTCTGGGGGACAAGACTCAGATAGTGGGACAGTCCATGTACAGCGAAGGG
AAGAACTCATCAGGAAGCACCTTCAAACTTCTAGTAGATGGAGGCCTATGCACCGATAAT
GATCTGAACGGCACGGACATAAAGGGAAGAGTTGTGCTGTGCACCTCCCTCGGGATACCA
CCGCTTATGCTTTTCCCGGTAGCATTGAAAAACGTCTTGGATGCTGGGGGTTCAGGTCTA
ATCTTCGCTCAATACACAACTGACATCCTGGACGTCACAAAAAACTGCAACGGCACTGCC
TGTGTTCTTGTGGACCTTGACACTGCACAACTGATCAGCTCATACATCAGCGGCACAAGC
TCACCAGTGGCAAAGATCGAACCACCACGCACTGTCACGGGTGAAGGGATACTGGCACCA
AAAGTGGCAGCATTCTCCTCGAGAGGTCCATCAGTTGATTACCCTGATATTATTAAGCCT
GATGTAGCTGCACCAGGATCCAACATTTTAGCAGCCGTGAAAGACGGATACAAACTTGAG
TCAGGAACATCAATGGCAACGCCACATGTTGCAGGCATTGTTGCGCTGCTGAAAGCTCTC
CATCCAGACTGGTCTCCAGCTGCAATAAAATCGGCAGTTGTTACTACTGCGTCTGTAACT
GATGAACGAGGCATGCCAATACTGGCAGAAGGAGTGCCTCGGAAGATCGCTGATCCGTTT
GACTACGGAAGTGGAAACATTAACCCAAACAGGGCAGCTGATCCTGGCCTCATTTATGAC
ATCGACCCAACAGATTACAACAAGTTCTTTGCGTGCACCATCAAGACATCTGCCAGCTGC
AATGCAACAATGCTACCTAGGTATCACCTGAACCTACCATCAATCGCTGTTCCTGATCTC
AGGGATCCAACAACTGTATCTAGAACAGTTAGAAATGTAGGTGAGGTTAATGCAGTTTAC
CACGCTGAAATCCAGTGCCCACCTGGAGTTAAAATGGTTGTTGAGCCATCTGTTCTTGTC
TTCGATGCTGCAAACAAAGTTCACACCTTCAAGGTTAGTTTTTCACCTCTATGGAAATTG
CAAGGGGACTATACATTTGGCAGCCTTACTTGGCACAATGACAACAAGTCAGTGAGAATT
CCAATAGCAGTCCAGATCACCATCCAAGATTTCTATGCAGATGTTGCATAA

Protein

737 aa

>Os01t0795000-01 Subtilase.
MEVHSCQHRLVSLLLLCFWMLFIRAHGSRKLYIAYLGDRKHARPDDVVASHHDTLSSVLG
SKDESLSSIIYNYKHGFSGFAAMLTAEQAEQLAELPEVISVQRSRRYRTATTRSWDFLGL
DYQKPSELLRRSNHGQEIIIGIIDTGIWPESRSFSDEGYGPVPARWKGVCQVGEGWGSNN
CSRKIIGARFYHAGVDEDDLKIDYLSPRDANGHGTHTASTAAGSVVEAVSFHGLAAGTAR
GGAPRARIAVYKSVWGRGGAGSGNSATVLAAIDDAMHDGVDVLSLSLEVQENSFGALHAV
QKGITVVYAAGNSGPVPQVVGNTAPWVITVAASKIDRSFPTVITLGDKTQIVGQSMYSEG
KNSSGSTFKLLVDGGLCTDNDLNGTDIKGRVVLCTSLGIPPLMLFPVALKNVLDAGGSGL
IFAQYTTDILDVTKNCNGTACVLVDLDTAQLISSYISGTSSPVAKIEPPRTVTGEGILAP
KVAAFSSRGPSVDYPDIIKPDVAAPGSNILAAVKDGYKLESGTSMATPHVAGIVALLKAL
HPDWSPAAIKSAVVTTASVTDERGMPILAEGVPRKIADPFDYGSGNINPNRAADPGLIYD
IDPTDYNKFFACTIKTSASCNATMLPRYHLNLPSIAVPDLRDPTTVSRTVRNVGEVNAVY
HAEIQCPPGVKMVVEPSVLVFDAANKVHTFKVSFSPLWKLQGDYTFGSLTWHNDNKSVRI
PIAVQITIQDFYADVA*

5'UTR

chr01:33668016..33668032 (+ strand) : 17 bp

CDS

chr01:33668033..33668122 (+ strand) : 90 bp

chr01:33668213..33668304 (+ strand) : 92 bp

chr01:33668471..33668568 (+ strand) : 98 bp

chr01:33668801..33668956 (+ strand) : 156 bp

chr01:33670049..33670668 (+ strand) : 620 bp

chr01:33670762..33670832 (+ strand) : 71 bp

chr01:33670918..33671169 (+ strand) : 252 bp

chr01:33671236..33671353 (+ strand) : 118 bp

chr01:33671457..33671628 (+ strand) : 172 bp

chr01:33671712..33672253 (+ strand) : 542 bp

3'UTR

chr01:33672254..33672415 (+ strand) : 162 bp

FASTA

>Os01t0795000-01 class=Sequence position=chr01:33668016..33672415 (+ strand)
ACCTAAAGAA AATAAAAATG GAAGTCCATT CTTGTCAGCA CCGTTTGGTT TCATTGCTGC TACTTTGTTT TTGGATGCTG
TTCATCAGAG CGCATGGATC ACGCAAGGTT AGCAACTTAG CATGCCTTCT TCAAGAATTG TTTCTCACTC GAGATAATTT
AACTCACTCA GAAATGTCTC AATGCCCTCT GTTATAGCTG TACATAGCGT ATCTCGGTGA CAGAAAGCAT GCACGCCCAG
ACGACGTTGT TGCTTCTCAC CATGATACGC TCTCGAGTGT TCTTGGAAGG TGACCTAGCT CCGTCAGTTA CTCAATTTAA
TTACTTCATA TTTTGCACCC TTTCACCTTT CTGGTTTTGC ACAAACGGTT CCTTGGCGAA CCATATGTAC TTTCAAATTC
AAGTGCATAA CAAACCGTTT CTTGAATTCT TGCCAACCAA ATGTTGAACT TTCAGTAAAG ACGAATCCTT ATCTTCCATC
ATCTATAACT ACAAGCATGG GTTCTCAGGC TTTGCTGCCA TGCTGACAGC TGAGCAGGCA GAACAGCTTG CAGGTCAGTT
AATCCTACCT AGAATTAGGT TCACATCCTC TACCATAATG ATACTACCAT TATAGACACT GATGTGTGGA ATAATAGGAG
GGTAGAACCC ACATGTTAGT GATTGTAATG GTAGTGCCAT TATGGTAGAG GATCAGGATA ATCTTGGTCT GCACACCAAT
CATAGATACT TCACACAAAT TCTGATTCTG ATGTGCGGTT TGCTTGATGT ACATTGTATC TCCAGAGTTA CCAGAAGTCA
TCAGCGTTCA GCGAAGCAGG AGGTACAGGA CGGCGACCAC ACGGAGCTGG GACTTCCTGG GGCTGGATTA CCAAAAGCCC
AGTGAATTAC TCAGAAGGAG CAACCACGGA CAAGAGATAA TCATCGGGAT TATTGACACC GGTTAGTCTA GGGGGCATGT
TTTAATTTTT TTTTGCGAGG TTTAAACGTT TATGGTGGCG CCATTTCTGG TGCAATCTAG TAAATaaact aggtgaaacc
ccgcgcattg ttgcgggaat ttagtatgat aacaataaaa aataatgtgt aagatagtta gataatatca gattaagtaa
attaatatgg tttatgataa tttaaattta aatagtatgt agaatgatga ttcaaacgta aaaagtaagc tggtatgact
ttatggaaaa agaaaagtag ggagatagtt tggaccgtag attaatcatt taaaggttgt gatatgactt aattcgagga
aaaaaggaga aagataattt gaaccataga ttaatcattg agtaaatttc acaaaactac agatactatg gctaaattat
cacaaaacta cagttttaac tcagtatatc acaaaactac acatttaaga tgaagtgtca caaaactaca tgtttggtaa
ctaaattatc ataaaactat aggtttaaaa ccaatttaat cacaaagtaa taatgcttat agctccacca taacaatagt
gctagggatt taaactacaa aagttgtagt tttgtgataa gttcaatatt aaatatgcat ttttgtgata cttaacctaa
aatctgtagt tttgtgataa atttggtgct aaatgtgtag ttttgtgata caactcctta aatctgtagt tttgtgataa
tttagtcaaa atacctgtag ttttgtgaaa tttactctta atcatttaaa caattactaa gtgaggataa actatataag
tatataggat gtcataaaag ataataaaga tatacattga aacattatgt gaattatatt ggatgataat ttaacatgtt
tgtatttgaa aaactcttaa attataaaaa ctataaagat atagtatatt tgcatgatgt ttaaatgtaa tgattgttgt
tggatgatga tgtgacatct tgttagtaga tgatgatatg gcatctttgc atgtcaagtt taagaagtta gtgggggata
actttatagt aagataggat GCACTTGCCA CAGGGATATG GCCGGAGTCA AGAAGTTTCA GCGACGAAGG ATACGGGCCG
GTGCCGGCAC GGTGGAAGGG CGTGTGCCAG GTCGGAGAAG GATGGGGCAG CAACAACTGC AGCCGCAAGA TCATCGGCGC
GCGGTTCTAC CACGCCGGGG TGGACGAGGA CGACCTCAAG ATCGACTACC TCTCGCCCCG CGACGCGAAC GGCCACGGCA
CGCACACGGC GTCCACCGCG GCGGGCTCCG TCGTGGAGGC GGTCAGCTTC CACGGGCTGG CCGCGGGCAC CGCCCGCGGC
GGCGCGCCCC GGGCGCGCAT CGCGGTGTAC AAGTCCGTCT GGGGCAGGGG CGGCGCCGGG TCAGGGAACT CCGCCACCGT
GCTCGCCGCC ATCGACGACG CCATGCACGA CGGCGTGGAC GTGCTATCCC TGTCCCTCGA GGTTCAGGAG AACTCGTTCG
GCGCGCTGCA CGCCGTCCAG AAGGGGATCA CCGTCGTGTA CGCCGCAGGG AACTCTGGAC CTGTGCCGCA GGTGGTTGGG
AACACGGCTC CATGGGTCAT CACAGTCGCA GCAAGCAAGA TCGATCGGTC TTTCCCGACC GTGATCACTC TGGGGGACAA
GACTCAGATA GTGGTAGGAG GCGCAAATGC GAACCATTTA TCACCTCATG GTGTGTGCTC AACTGCTCAA CGGCTGATCT
TGTGCGAAAC TCTGGCTATT TTGCAGGGAC AGTCCATGTA CAGCGAAGGG AAGAACTCAT CAGGAAGCAC CTTCAAACTT
CTAGTAGATG GAGGCCTGTA TGAAAAAAAA TGCCTTTGCC AATATTTTTT TCTGCTTAAT TTATAAGAAG CTAATGAGCT
GTTCGTTTTC TTGTGTGGAT AGATGCACCG ATAATGATCT GAACGGCACG GACATAAAGG GAAGAGTTGT GCTGTGCACC
TCCCTCGGGA TACCACCGCT TATGCTTTTC CCGGTAGCAT TGAAAAACGT CTTGGATGCT GGGGGTTCAG GTCTAATCTT
CGCTCAATAC ACAACTGACA TCCTGGACGT CACAAAAAAC TGCAACGGCA CTGCCTGTGT TCTTGTGGAC CTTGACACTG
CACAACTGAT CAGCTCATAC ATCAGCGGCA CAAGGTAAAA CAAATTGCAA ACTTCTCTAA TGAGTTCAAC ACTTCCTAAA
CTATTATCGT ATTTAAGCAG CTCACCAGTG GCAAAGATCG AACCACCACG CACTGTCACG GGTGAAGGGA TACTGGCACC
AAAAGTGGCA GCATTCTCCT CGAGAGGTCC ATCAGTTGAT TACCCTGATA TTATTAAGGT AGCTAACTCC AACTTAGCAC
TCAGCTAGGC GCTAGAGGTT CATCCGATGA AAGCCGGGGA ATTTCTTCAT CTTACCAGCG GTCTGGTTGC TTCTGTAACA
GCCTGATGTA GCTGCACCAG GATCCAACAT TTTAGCAGCC GTGAAAGACG GATACAAACT TGAGTCAGGA ACATCAATGG
CAACGCCACA TGTTGCAGGC ATTGTTGCGC TGCTGAAAGC TCTCCATCCA GACTGGTCTC CAGCTGCAAT AAAATCGGCA
GTTGTTACTA CTGGTACAGA AATTCAATAC CCCAACCTCT AAATCGTTCC TGTGATTTTC TGCAATCTTA CCCATGTTTC
ATTTTGCATA CTGAAGCGTC TGTAACTGAT GAACGAGGCA TGCCAATACT GGCAGAAGGA GTGCCTCGGA AGATCGCTGA
TCCGTTTGAC TACGGAAGTG GAAACATTAA CCCAAACAGG GCAGCTGATC CTGGCCTCAT TTATGACATC GACCCAACAG
ATTACAACAA GTTCTTTGCG TGCACCATCA AGACATCTGC CAGCTGCAAT GCAACAATGC TACCTAGGTA TCACCTGAAC
CTACCATCAA TCGCTGTTCC TGATCTCAGG GATCCAACAA CTGTATCTAG AACAGTTAGA AATGTAGGTG AGGTTAATGC
AGTTTACCAC GCTGAAATCC AGTGCCCACC TGGAGTTAAA ATGGTTGTTG AGCCATCTGT TCTTGTCTTC GATGCTGCAA
ACAAAGTTCA CACCTTCAAG GTTAGTTTTT CACCTCTATG GAAATTGCAA GGGGACTATA CATTTGGCAG CCTTACTTGG
CACAATGACA ACAAGTCAGT GAGAATTCCA ATAGCAGTCC AGATCACCAT CCAAGATTTC TATGCAGATG TTGCATAACC
TGGGCAAAAC ATGCAGGCAA TAACACAGTG CTCTTAGAGG CAATAGAGCA AAATACAGGA TATACCAATT TCCACAGAGA
TATGGTTGCT TGTAAATACT TATCACCAGA ATAATGAGTT AATGACCGGC CAATGTTGAC TGGTCAATGT ATTTCATTTC

Locus: Os01g0795000

Loading...

Locus: Os01g0795000

Loading...