Os01t0805600-01

Locus

Os01g0805600

Description

Similar to Cyclin-B1-1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYCB1;1

CGSNL Gene Name

CYCLIN-B1-1

Oryzabase Gene Symbol Synonym(s)

CycB1;1, CycB1;os;1, Orysa;CycB1;1, OsCycB1;1, CyclaZm, CYCIaZm, OsCYCIaZm

Oryzabase Gene Name Synonym(s)

B-type cyclin 1;1

Transcript Evidence

AK111939 (DDBJ, Best hit)

Protein Evidence

Q0JIF2 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of cyclin-dependent protein kinase activity (GO:0000079)

Biological Process: regulation of cell cycle (GO:0051726)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein kinase binding (GO:0019901)

Functional domain (InterPro)

Cyclin, C-terminal (IPR004367)

Cyclin, N-terminal (IPR006671)

Cyclin-like (IPR013763)

Cyclin A/B/D/E (IPR014400)

Full-length cDNA

001-020-G01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0805600-01)

Others

Oryzabase (13260)

Transcript

1251 bp

>Os01t0805600-01 Similar to Cyclin-B1-1.
GATCAGCTCTGATTCTGACCAGAGCATGAGGCAGCAGTCGGAGGGCAGCGCCAGCTCTGT
CCGCAAGTGCTCGAGGAAGAAGGTCATCAACACCCTCACCTCCGTGCTCACTGCACGATC
AAAGGTTGCCTGTGGAATCACTGACAAACCTCGAGAAGTGATTGAGGACATTGACAAGCT
CGACGGTGACAATGAGCTGGCTGTGGTGGACTATATTGAGGATATCTACAAGTTCTACAA
GGTCGCTGAGAACGAGTGCCGCCCGTGTGATTACATCGACACCCAGGTGGAGATCAATTC
CAAGATGAGGGCCATCCTGGCAGACTGGATAATTGAAGTGCATCACAAGTTTGAGCTCAT
GCCAGAGACCCTATACCTCTCCATGTATGTCATCGACCGGTACCTCTCGATGCAGCAAGT
GCAGCGGAGGGAGCTGCAGCTGGTAGGTGTCTCTGCCATGCTGATAGCTTGCAAGTACGA
GGAGATTTGGGCCCCAGAGGTGAACGACTTCATCTTGATATCAGATAGTGCATACACTAG
GGAACAGATTCTTGCAATGGAGAAGGGGATTCTGAATAAGCTTCAGTGGAATCTCACCGT
TCCTACAGCATATGTCTTCATTATGCGCTATCTGAAGGCGGGGGCGTCTGCAGATAACAA
AAGTGACAAGGAGATGGAGCACATGGCCTTCTTCTTCGCTGAATTGGCACTGATGCAGTA
CGGGCTGGTGGCATCCCTGCCTTCCAAGGTTGCTGCCTCTGCTGTCTATGCAGCCAGGCT
CACCCTGAAGAAGAGCCCTCTATGGACTGACACTCTCAAGCACCACACTGGATTTACCGA
GTCACAGCTATTGGACTCTGCAAAGCTTCTTGTTACCTCGCACTCTACTGCCCCTGAGAG
CAAGCTGAGGGTTGTGTACAAGAAGTATTCCAGTGAGCAGCTTGGAGGAGTGGCACTTCG
CTCACCAGCAGTGGAACTCTGCAAATAAATGGAGATTAGCTTTGTCTCGTATTTCGTTTG
CTTATTTGGTTTAGAGTGCAATGGAAGGCGAGTCTGACATTCATTAGGCGTTTGCTTGTT
TTGGAGTCAAGAAAGTTTGGAATCTTGACACGCTTGCTATGACTTCTAATGGCCAGGATT
TGGCCTTTATGTGATAATACACCTTGGTGTATATAAACTGTCATCTGAATCTTATCAATA
ACGGTTCTTGATAAGTATGAATGATGATCGAATTACATGTTTGCATACAAC

CDS

963 bp

>Os01t0805600-01 Similar to Cyclin-B1-1.
ATGAGGCAGCAGTCGGAGGGCAGCGCCAGCTCTGTCCGCAAGTGCTCGAGGAAGAAGGTC
ATCAACACCCTCACCTCCGTGCTCACTGCACGATCAAAGGTTGCCTGTGGAATCACTGAC
AAACCTCGAGAAGTGATTGAGGACATTGACAAGCTCGACGGTGACAATGAGCTGGCTGTG
GTGGACTATATTGAGGATATCTACAAGTTCTACAAGGTCGCTGAGAACGAGTGCCGCCCG
TGTGATTACATCGACACCCAGGTGGAGATCAATTCCAAGATGAGGGCCATCCTGGCAGAC
TGGATAATTGAAGTGCATCACAAGTTTGAGCTCATGCCAGAGACCCTATACCTCTCCATG
TATGTCATCGACCGGTACCTCTCGATGCAGCAAGTGCAGCGGAGGGAGCTGCAGCTGGTA
GGTGTCTCTGCCATGCTGATAGCTTGCAAGTACGAGGAGATTTGGGCCCCAGAGGTGAAC
GACTTCATCTTGATATCAGATAGTGCATACACTAGGGAACAGATTCTTGCAATGGAGAAG
GGGATTCTGAATAAGCTTCAGTGGAATCTCACCGTTCCTACAGCATATGTCTTCATTATG
CGCTATCTGAAGGCGGGGGCGTCTGCAGATAACAAAAGTGACAAGGAGATGGAGCACATG
GCCTTCTTCTTCGCTGAATTGGCACTGATGCAGTACGGGCTGGTGGCATCCCTGCCTTCC
AAGGTTGCTGCCTCTGCTGTCTATGCAGCCAGGCTCACCCTGAAGAAGAGCCCTCTATGG
ACTGACACTCTCAAGCACCACACTGGATTTACCGAGTCACAGCTATTGGACTCTGCAAAG
CTTCTTGTTACCTCGCACTCTACTGCCCCTGAGAGCAAGCTGAGGGTTGTGTACAAGAAG
TATTCCAGTGAGCAGCTTGGAGGAGTGGCACTTCGCTCACCAGCAGTGGAACTCTGCAAA
TAA

Protein

321 aa

>Os01t0805600-01 Similar to Cyclin-B1-1.
MRQQSEGSASSVRKCSRKKVINTLTSVLTARSKVACGITDKPREVIEDIDKLDGDNELAV
VDYIEDIYKFYKVAENECRPCDYIDTQVEINSKMRAILADWIIEVHHKFELMPETLYLSM
YVIDRYLSMQQVQRRELQLVGVSAMLIACKYEEIWAPEVNDFILISDSAYTREQILAMEK
GILNKLQWNLTVPTAYVFIMRYLKAGASADNKSDKEMEHMAFFFAELALMQYGLVASLPS
KVAASAVYAARLTLKKSPLWTDTLKHHTGFTESQLLDSAKLLVTSHSTAPESKLRVVYKK
YSSEQLGGVALRSPAVELCK*

5'UTR

chr01:34151182..34151206 (- strand) : 25 bp

CDS

chr01:34151083..34151181 (- strand) : 99 bp

chr01:34150850..34150975 (- strand) : 126 bp

chr01:34150499..34150747 (- strand) : 249 bp

chr01:34150238..34150411 (- strand) : 174 bp

chr01:34149954..34150132 (- strand) : 179 bp

chr01:34149721..34149856 (- strand) : 136 bp

3'UTR

chr01:34149458..34149720 (- strand) : 263 bp

FASTA

>Os01t0805600-01 class=Sequence position=chr01:34149458..34151206 (- strand)
GATCAGCTCT GATTCTGACC AGAGCATGAG GCAGCAGTCG GAGGGCAGCG CCAGCTCTGT CCGCAAGTGC TCGAGGAAGA
AGGTCATCAA CACCCTCACC TCCGTGCTCA CTGCACGATC AAAGGTGGGT TATCCACTGA AAATTTCAAA AAGAAAAAAA
AAATTCTGCA TACCAATCAC TGACAGGTTA TCTTAAGTTC TTAACCTGTA TTTACTCCAT GCTAATGCCA GGTTGCCTGT
GGAATCACTG ACAAACCTCG AGAAGTGATT GAGGACATTG ACAAGCTCGA CGGTGACAAT GAGCTGGCTG TGGTGGACTA
TATTGAGGAT ATCTACAAGT TCTACAAGGT CGCTGAGGTA ACTGAGTCGC TCTCTCTGCT TGATCCTTCT TCGATGCCTA
CGCAAATGCT GTATGTGCTT GGTCACTGAA AGGTGCAATC TTTCCTGGCC TTGCTGCAGA ACGAGTGCCG CCCGTGTGAT
TACATCGACA CCCAGGTGGA GATCAATTCC AAGATGAGGG CCATCCTGGC AGACTGGATA ATTGAAGTGC ATCACAAGTT
TGAGCTCATG CCAGAGACCC TATACCTCTC CATGTATGTC ATCGACCGGT ACCTCTCGAT GCAGCAAGTG CAGCGGAGGG
AGCTGCAGCT GGTAGGTGTC TCTGCCATGC TGATAGCTTG CAAGTACGAG GAGATTTGGG CCCCAGAGGT AGCAACATTT
TTAGCCCCTT TGCTCTGCAC TGCCCATTTC TAGCAGGGAC TTGTTCTGAT TGGATCTCTG TCTATGTATT TGCAGGTGAA
CGACTTCATC TTGATATCAG ATAGTGCATA CACTAGGGAA CAGATTCTTG CAATGGAGAA GGGGATTCTG AATAAGCTTC
AGTGGAATCT CACCGTTCCT ACAGCATATG TCTTCATTAT GCGCTATCTG AAGGCGGGGG CGTCTGCAGA TAACAAAAGT
GACAAGGAGG TAAAGAGCCA TGGCTTCTGT TTGTTTCTGT TTACCATCGG ATTATATTTC ATTGCTAAGC AACAAGTTTG
AGCGTGTACT CAAAATTTCT TTTGGTGAAT GCAGATGGAG CACATGGCCT TCTTCTTCGC TGAATTGGCA CTGATGCAGT
ACGGGCTGGT GGCATCCCTG CCTTCCAAGG TTGCTGCCTC TGCTGTCTAT GCAGCCAGGC TCACCCTGAA GAAGAGCCCT
CTATGGACTG ACACTCTCAA GCACCACACT GGATTTACCG AGTCACAGCT ATTGTAAGCA CTACATGACT CGATGACTTG
TTTAACTAGC ATCACTGAAA TTCTCCATTG AGCAGATATA CTGAACTTTA TTTTTCTGCG ATGATTTCAG GGACTCTGCA
AAGCTTCTTG TTACCTCGCA CTCTACTGCC CCTGAGAGCA AGCTGAGGGT TGTGTACAAG AAGTATTCCA GTGAGCAGCT
TGGAGGAGTG GCACTTCGCT CACCAGCAGT GGAACTCTGC AAATAAATGG AGATTAGCTT TGTCTCGTAT TTCGTTTGCT
TATTTGGTTT AGAGTGCAAT GGAAGGCGAG TCTGACATTC ATTAGGCGTT TGCTTGTTTT GGAGTCAAGA AAGTTTGGAA
TCTTGACACG CTTGCTATGA CTTCTAATGG CCAGGATTTG GCCTTTATGT GATAATACAC CTTGGTGTAT ATAAACTGTC
ATCTGAATCT TATCAATAAC GGTTCTTGAT AAGTATGAAT GATGATCGAA TTACATGTTT GCATACAAC

Locus: Os01g0805600

Loading...

Locus: Os01g0805600

Loading...