Os01t0805600-02

Locus

Os01g0805600

Description

Cyclin-B1-1, Endosperm formation via the regulation of mitotic division

RAP-DB Gene Symbol Synonym(s)

Orysa;CycB1;1

RAP-DB Gene Name Synonym(s)

Cyclin-B1-1

CGSNL Gene Symbol

CYCB1;1

CGSNL Gene Name

CYCLIN-B1-1

Oryzabase Gene Symbol Synonym(s)

CycB1;1, CycB1;os;1, Orysa;CycB1;1, OsCycB1;1, CyclaZm, CYCIaZm, OsCYCIaZm

Oryzabase Gene Name Synonym(s)

B-type cyclin 1;1

Transcript Evidence

Inferred from literature

Protein Evidence

Q0JIF2

Literature

PMID: 19921249

Note

Manual Curation

December 3, 2020

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Cyclin-like superfamily (IPR036915)

Cyclin (IPR039361)

Cyclin, N-terminal (IPR006671)

Cyclin-like (IPR013763)

Cyclin, C-terminal domain (IPR004367)

Others

Oryzabase (13260)

Transcript

1949 bp

>Os01t0805600-02 Cyclin-B1-1, Endosperm formation via the regulation of mitotic division
GCGCCCTGCCCTAGCTCGCTATATCTCGCCCCTCCTCCACGCGCCGCCTCCAAGAACTGT
ATACCACCACGCATCAATCACACGCCGCACGCCGACGCCGATTGGTTGATTTGATTGATT
GATTGGGCAAGAGGAGGAGGAGGAAGGGGATTGTTTGCTGCTGCTGCTGCTCCAGAGCTC
GCCggagccgcggtggctgcagcgctcgacggcggggaagaggggtcgcgggcggcgcgg
cTGCACTCGTTCTTCGCCTCGGTGATCTCCGGGATCTTCGGCCAGGGCGAGGAGGAGGAG
GAAGGGGAGATGGCGACACGCAGCCAGAACGTCGCTGCCGCTCCGCAGCCGCCGCAGAAC
AGAGGCAATGTTGCCGCTCTGGGAAAGCAGAAGGCCGTCGTGGCCGGCAGGCCCGACGCG
AAGAACCGGCGAGCCCTTGGCGAGATCGGCAACGTCATGAACGTCCGCCTACCGGAAGGC
AAGCCTCTGCAGCAGGCGCCGGCCGGCCGCACCGCCAACTTTGGTGCCCAACTGCTGAAG
AACGCGCAGGCAAATGCTGCGGCAAACAAGCAGAATGCAGTTGCACCTGCTGCCGTGGCG
AGGCCTGCGCAGAGGCAGGCCAGGAAGGCGCCTGTCAAGCCCGCGCCTCCTCCGCCCGAG
CATGTCATCGAGATCAGCTCTGATTCTGACCAGAGCATGAGGCAGCAGTCGGAGGGCAGC
GCCAGCTCTGTCCGCAAGTGCTCGAGGAAGAAGGTCATCAACACCCTCACCTCCGTGCTC
ACTGCACGATCAAAGGTTGCCTGTGGAATCACTGACAAACCTCGAGAAGTGATTGAGGAC
ATTGACAAGCTCGACGGTGACAATGAGCTGGCTGTGGTGGACTATATTGAGGATATCTAC
AAGTTCTACAAGGTCGCTGAGAACGAGTGCCGCCCGTGTGATTACATCGACACCCAGGTG
GAGATCAATTCCAAGATGAGGGCCATCCTGGCAGACTGGATAATTGAAGTGCATCACAAG
TTTGAGCTCATGCCAGAGACCCTATACCTCTCCATGTATGTCATCGACCGGTACCTCTCG
ATGCAGCAAGTGCAGCGGAGGGAGCTGCAGCTGGTAGGTGTCTCTGCCATGCTGATAGCT
TGCAAGTACGAGGAGATTTGGGCCCCAGAGGTGAACGACTTCATCTTGATATCAGATAGT
GCATACACTAGGGAACAGATTCTTGCAATGGAGAAGGGGATTCTGAATAAGCTTCAGTGG
AATCTCACCGTTCCTACAGCATATGTCTTCATTATGCGCTATCTGAAGGCGGGGGCGTCT
GCAGATAACAAAAGTGACAAGGAGATGGAGCACATGGCCTTCTTCTTCGCTGAATTGGCA
CTGATGCAGTACGGGCTGGTGGCATCCCTGCCTTCCAAGGTTGCTGCCTCTGCTGTCTAT
GCAGCCAGGCTCACCCTGAAGAAGAGCCCTCTATGGACTGACACTCTCAAGCACCACACT
GGATTTACCGAGTCACAGCTATTGGACTCTGCAAAGCTTCTTGTTACCTCGCACTCTACT
GCCCCTGAGAGCAAGCTGAGGGTTGTGTACAAGAAGTATTCCAGTGAGCAGCTTGGAGGA
GTGGCACTTCGCTCACCAGCAGTGGAACTCTGCAAATAAATGGAGATTAGCTTTGTCTCG
TATTTCGTTTGCTTATTTGGTTTAGAGTGCAATGGAAGGCGAGTCTGACATTCATTAGGC
GTTTGCTTGTTTTGGAGTCAAGAAAGTTTGGAATCTTGACACGCTTGCTATGACTTCTAA
TGGCCAGGATTTGGCCTTTATGTGATAATACACCTTGGTGTATATAAACTGTCATCTGAA
TCTTATCAATAACGGTTCTTGATAAGTATGAATGATGATCGAATTACATGTTTGCATACA
ACAATCTCGTGTCTTGAATCGATCCCATA

CDS

1350 bp

>Os01t0805600-02 Cyclin-B1-1, Endosperm formation via the regulation of mitotic division
ATGGCGACACGCAGCCAGAACGTCGCTGCCGCTCCGCAGCCGCCGCAGAACAGAGGCAAT
GTTGCCGCTCTGGGAAAGCAGAAGGCCGTCGTGGCCGGCAGGCCCGACGCGAAGAACCGG
CGAGCCCTTGGCGAGATCGGCAACGTCATGAACGTCCGCCTACCGGAAGGCAAGCCTCTG
CAGCAGGCGCCGGCCGGCCGCACCGCCAACTTTGGTGCCCAACTGCTGAAGAACGCGCAG
GCAAATGCTGCGGCAAACAAGCAGAATGCAGTTGCACCTGCTGCCGTGGCGAGGCCTGCG
CAGAGGCAGGCCAGGAAGGCGCCTGTCAAGCCCGCGCCTCCTCCGCCCGAGCATGTCATC
GAGATCAGCTCTGATTCTGACCAGAGCATGAGGCAGCAGTCGGAGGGCAGCGCCAGCTCT
GTCCGCAAGTGCTCGAGGAAGAAGGTCATCAACACCCTCACCTCCGTGCTCACTGCACGA
TCAAAGGTTGCCTGTGGAATCACTGACAAACCTCGAGAAGTGATTGAGGACATTGACAAG
CTCGACGGTGACAATGAGCTGGCTGTGGTGGACTATATTGAGGATATCTACAAGTTCTAC
AAGGTCGCTGAGAACGAGTGCCGCCCGTGTGATTACATCGACACCCAGGTGGAGATCAAT
TCCAAGATGAGGGCCATCCTGGCAGACTGGATAATTGAAGTGCATCACAAGTTTGAGCTC
ATGCCAGAGACCCTATACCTCTCCATGTATGTCATCGACCGGTACCTCTCGATGCAGCAA
GTGCAGCGGAGGGAGCTGCAGCTGGTAGGTGTCTCTGCCATGCTGATAGCTTGCAAGTAC
GAGGAGATTTGGGCCCCAGAGGTGAACGACTTCATCTTGATATCAGATAGTGCATACACT
AGGGAACAGATTCTTGCAATGGAGAAGGGGATTCTGAATAAGCTTCAGTGGAATCTCACC
GTTCCTACAGCATATGTCTTCATTATGCGCTATCTGAAGGCGGGGGCGTCTGCAGATAAC
AAAAGTGACAAGGAGATGGAGCACATGGCCTTCTTCTTCGCTGAATTGGCACTGATGCAG
TACGGGCTGGTGGCATCCCTGCCTTCCAAGGTTGCTGCCTCTGCTGTCTATGCAGCCAGG
CTCACCCTGAAGAAGAGCCCTCTATGGACTGACACTCTCAAGCACCACACTGGATTTACC
GAGTCACAGCTATTGGACTCTGCAAAGCTTCTTGTTACCTCGCACTCTACTGCCCCTGAG
AGCAAGCTGAGGGTTGTGTACAAGAAGTATTCCAGTGAGCAGCTTGGAGGAGTGGCACTT
CGCTCACCAGCAGTGGAACTCTGCAAATAA

Protein

450 aa

>Os01t0805600-02 Cyclin-B1-1, Endosperm formation via the regulation of mitotic division
MATRSQNVAAAPQPPQNRGNVAALGKQKAVVAGRPDAKNRRALGEIGNVMNVRLPEGKPL
QQAPAGRTANFGAQLLKNAQANAAANKQNAVAPAAVARPAQRQARKAPVKPAPPPPEHVI
EISSDSDQSMRQQSEGSASSVRKCSRKKVINTLTSVLTARSKVACGITDKPREVIEDIDK
LDGDNELAVVDYIEDIYKFYKVAENECRPCDYIDTQVEINSKMRAILADWIIEVHHKFEL
MPETLYLSMYVIDRYLSMQQVQRRELQLVGVSAMLIACKYEEIWAPEVNDFILISDSAYT
REQILAMEKGILNKLQWNLTVPTAYVFIMRYLKAGASADNKSDKEMEHMAFFFAELALMQ
YGLVASLPSKVAASAVYAARLTLKKSPLWTDTLKHHTGFTESQLLDSAKLLVTSHSTAPE
SKLRVVYKKYSSEQLGGVALRSPAVELCK*

5'UTR

chr01:34152109..34152417 (- strand) : 309 bp

CDS

chr01:34152054..34152108 (- strand) : 55 bp

chr01:34151579..34151693 (- strand) : 115 bp

chr01:34151399..34151489 (- strand) : 91 bp

chr01:34151083..34151307 (- strand) : 225 bp

chr01:34150850..34150975 (- strand) : 126 bp

chr01:34150499..34150747 (- strand) : 249 bp

chr01:34150238..34150411 (- strand) : 174 bp

chr01:34149954..34150132 (- strand) : 179 bp

chr01:34149721..34149856 (- strand) : 136 bp

3'UTR

chr01:34149431..34149720 (- strand) : 290 bp

FASTA

>Os01t0805600-02 class=Sequence position=chr01:34149431..34152417 (- strand)
GCGCCCTGCC CTAGCTCGCT ATATCTCGCC CCTCCTCCAC GCGCCGCCTC CAAGAACTGT ATACCACCAC GCATCAATCA
CACGCCGCAC GCCGACGCCG ATTGGTTGAT TTGATTGATT GATTGGGCAA GAGGAGGAGG AGGAAGGGGA TTGTTTGCTG
CTGCTGCTGC TCCAGAGCTC GCCggagccg cggtggctgc agcgctcgac ggcggggaag aggggtcgcg ggcggcgcgg
cTGCACTCGT TCTTCGCCTC GGTGATCTCC GGGATCTTCG GCCAGGGCGA GGAGGAGGAG GAAGGGGAGA TGGCGACACG
CAGCCAGAAC GTCGCTGCCG CTCCGCAGCC GCCGCAGAAC AGAGGTGAGC GAAAACAGCG TGTCTCAGAT CTTTGGGGCT
TTGGCGGCTG CGCGGATTCG AGTTCTTGTC GTGTTCCTCG TTAGTTTCCT GTTCGGATCC TGTCCCAAGA TTGGGTTTTT
TTTTTTTACA CGAGTTGCCT TATCTTTGGG TAGGCTTCTC TTCCCCCCAA ACTTGGTACT CATCGGTTCA TTGTCCAGCT
CCAGCAGTTG ATCTTTGTTC TTGTTCTTAT TATTTCATTT ACCTGCTTTT TGATTGGATT TCTGAAGAAA AGATTCCAAT
TTGATCCCTA TTTGGTGGTG TTGTTCAGTC CGACTTCTCA AAATCGCGAA ATTCTCATAG CGTCTGTCTC CTGCTCAATT
TCAGGCAATG TTGCCGCTCT GGGAAAGCAG AAGGCCGTCG TGGCCGGCAG GCCCGACGCG AAGAACCGGC GAGCCCTTGG
CGAGATCGGC AACGTCATGA ACGTCCGCCT ACCGGAAGGG TACGTGATAC GACCAATCGC TTAGCCTCAC GCTGTCATAA
TTTCTTCTGC TCTTTATCTG AAACCTTCAC TTGTGTTCAT GTAAACAGCA AGCCTCTGCA GCAGGCGCCG GCCGGCCGCA
CCGCCAACTT TGGTGCCCAA CTGCTGAAGA ACGCGCAGGC AAATGCTGCG GCAAACAAGG TACATCGGCC AACCAAATCC
TTCTTTCATT CTTTGTCTTG ATTCTTGAAG CATCTGAATC TGAACCTTAC TGAAACTATT GGGTCTGCAG CAGAATGCAG
TTGCACCTGC TGCCGTGGCG AGGCCTGCGC AGAGGCAGGC CAGGAAGGCG CCTGTCAAGC CCGCGCCTCC TCCGCCCGAG
CATGTCATCG AGATCAGCTC TGATTCTGAC CAGAGCATGA GGCAGCAGTC GGAGGGCAGC GCCAGCTCTG TCCGCAAGTG
CTCGAGGAAG AAGGTCATCA ACACCCTCAC CTCCGTGCTC ACTGCACGAT CAAAGGTGGG TTATCCACTG AAAATTTCAA
AAAGAAAAAA AAAATTCTGC ATACCAATCA CTGACAGGTT ATCTTAAGTT CTTAACCTGT ATTTACTCCA TGCTAATGCC
AGGTTGCCTG TGGAATCACT GACAAACCTC GAGAAGTGAT TGAGGACATT GACAAGCTCG ACGGTGACAA TGAGCTGGCT
GTGGTGGACT ATATTGAGGA TATCTACAAG TTCTACAAGG TCGCTGAGGT AACTGAGTCG CTCTCTCTGC TTGATCCTTC
TTCGATGCCT ACGCAAATGC TGTATGTGCT TGGTCACTGA AAGGTGCAAT CTTTCCTGGC CTTGCTGCAG AACGAGTGCC
GCCCGTGTGA TTACATCGAC ACCCAGGTGG AGATCAATTC CAAGATGAGG GCCATCCTGG CAGACTGGAT AATTGAAGTG
CATCACAAGT TTGAGCTCAT GCCAGAGACC CTATACCTCT CCATGTATGT CATCGACCGG TACCTCTCGA TGCAGCAAGT
GCAGCGGAGG GAGCTGCAGC TGGTAGGTGT CTCTGCCATG CTGATAGCTT GCAAGTACGA GGAGATTTGG GCCCCAGAGG
TAGCAACATT TTTAGCCCCT TTGCTCTGCA CTGCCCATTT CTAGCAGGGA CTTGTTCTGA TTGGATCTCT GTCTATGTAT
TTGCAGGTGA ACGACTTCAT CTTGATATCA GATAGTGCAT ACACTAGGGA ACAGATTCTT GCAATGGAGA AGGGGATTCT
GAATAAGCTT CAGTGGAATC TCACCGTTCC TACAGCATAT GTCTTCATTA TGCGCTATCT GAAGGCGGGG GCGTCTGCAG
ATAACAAAAG TGACAAGGAG GTAAAGAGCC ATGGCTTCTG TTTGTTTCTG TTTACCATCG GATTATATTT CATTGCTAAG
CAACAAGTTT GAGCGTGTAC TCAAAATTTC TTTTGGTGAA TGCAGATGGA GCACATGGCC TTCTTCTTCG CTGAATTGGC
ACTGATGCAG TACGGGCTGG TGGCATCCCT GCCTTCCAAG GTTGCTGCCT CTGCTGTCTA TGCAGCCAGG CTCACCCTGA
AGAAGAGCCC TCTATGGACT GACACTCTCA AGCACCACAC TGGATTTACC GAGTCACAGC TATTGTAAGC ACTACATGAC
TCGATGACTT GTTTAACTAG CATCACTGAA ATTCTCCATT GAGCAGATAT ACTGAACTTT ATTTTTCTGC GATGATTTCA
GGGACTCTGC AAAGCTTCTT GTTACCTCGC ACTCTACTGC CCCTGAGAGC AAGCTGAGGG TTGTGTACAA GAAGTATTCC
AGTGAGCAGC TTGGAGGAGT GGCACTTCGC TCACCAGCAG TGGAACTCTG CAAATAAATG GAGATTAGCT TTGTCTCGTA
TTTCGTTTGC TTATTTGGTT TAGAGTGCAA TGGAAGGCGA GTCTGACATT CATTAGGCGT TTGCTTGTTT TGGAGTCAAG
AAAGTTTGGA ATCTTGACAC GCTTGCTATG ACTTCTAATG GCCAGGATTT GGCCTTTATG TGATAATACA CCTTGGTGTA
TATAAACTGT CATCTGAATC TTATCAATAA CGGTTCTTGA TAAGTATGAA TGATGATCGA ATTACATGTT TGCATACAAC
AATCTCGTGT CTTGAATCGA TCCCATA

Locus: Os01g0805600

Loading...

Locus: Os01g0805600

Loading...