Os01t0818000-01

Locus

Os01g0818000

Description

Auxin efflux carrier domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS6a, PILS6a

Oryzabase Gene Name Synonym(s)

PIN likes 6a

Transcript Evidence

AK069848 (DDBJ, Best hit)

Protein Evidence

XP_002870888.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Auxin efflux carrier (IPR004776)

Full-length cDNA

J023034N13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0818000-01)

RiceXPro (AK069848)

Others

Oryzabase (19848)

KEGG (Os01t0818000-01)

Transcript

1969 bp

>Os01t0818000-01 Auxin efflux carrier domain containing protein.
ATCCGATAGCTTAATCTCGAGCGCTTCGAGTTCGATCTCTCGTGAAGGGGACGACGAGGG
CATTGTCTCCCTCCTCGCGCGCGCGGAGTCGCCGCCGCCGCCGCCTCGTCCTCGGCCACG
CGGAAGTGAAGAAGAAGAAGAAGAAGTGAACTAGTGAAGCCTGGGGCAAGCCATGATGGA
GAGGTCGCTGATGGAGGCGCTGGCTACGGCGGCGCAGGGAGGCACCGTGGGGACGTCGGT
TTTCGACATGCTCAAGTACGCCGTGCTGCCCATTGCCAAGGTGTTTACCGTCTGTTTCAT
GGGGTTCCTCATGGCCTCTAAGTATGTCAATATCCTCCAGCCGAACGGCCGCAAGCTTCT
CAATGGGCTTGTGTTCTCGCTTCTACTTCCTTGCCTTATATTTTCCCAACTGGGTAGAGC
AATCACAATCGAAAAGATGCTGCAATGGTGGTATATTCCAGTAAATATTGTTGTAGGTGC
AGTGTCAGGCTCTTTGATTGGCTTTGTGGTGGCTTCTATCATCCGACCACCTTATCCATA
CTTCAAGTTCACTGTGATTCACATTGGAATAGGGAATATTGGAAATATACCTCTGGTTCT
CATTGCAGCATTATGTCGAGATCCCACCAATCCTTTTGGTGACTCTGATAAATGTAATGA
AGATGGGAATGCGTATATCTCATTTGGTCAATGGGTTGGTGCAATTATTGTTTACACATA
TGTGTTCAAGATGCTTGCTCCACCACCTGGTGAATCCTTTGATAGCGCTGAAGAAGATAT
TCTTCCAATTAAGGCATCTGGAGATAATGTGGTGCCTGAAAAAGGGAAATATCCAACAAG
CACTCGCACTAGTACTGTACCTGAAAATGAGCCTTTGTTATCTTCTGAAGGTGATAAAAA
TGTTTCTACTTCTCTAGGATCGAAGATAATGGGCATTGTTAGAAGCATGGTTAAGTTCCT
AAAAGACAAGCAGCTTCTTCAGCCACCAATTATTGCCTCTGTTTTTGCAATTGCCATTGG
TGTTGTTCCAGTCTTGAAGAATTTTGTCCTCACTGATGATGCACCTCTGTTCTTCTTCAC
AGACAGCTGTCTCATTCTAGGGGAAGCAATGATCCCTTGCATTTTGCTTGCAGTGGGGGG
CAATCTTGTCGATGGTCCTGGTGAAGGAAGTAACAGGCTTGGTGTGCGGACAACCGTTGC
TATTATTTTTGCACGGCTCATCTTGGTTCCTCTTGCTGGGGTTGGCATCATTGTGTTGGT
TGATAAACTTGGTTTCATTCCTAAAGATGACAAAATGTTCAAGTTTGTCTTGCTACTGCA
GCATTCTATGCCCACATCTGTGCTGTCAGGTGCTGTTGCAAACCTGAGGGGCTGTGGAAA
AGAATCTGCTGCTATCTTGTTCTGGGTGCACATCTTTGCTGTGTTCTCCATGGCAGGATG
GATTATTTTGTATTTGAGCTTACTCTTCTAAGTACGTCATACCCTGATGCTATACTGCAC
AGGAACGTCCATAAGATCAAAATATCACCAGATATACCAGAAAAAGATAGTACCATGACA
TGTACATTAGCCAGTAAACCATGGCGACAGCCTGAAGGTACGAGTTGTATCAGTATTCAG
TATAGATATGGTTCTCCTGCCCAGTGCCCAATCGCTTAAGCGCCACTGCTATGTTAATTT
TGCTAATCGCTCGCTGCTACAAGCAACTGAGCAATGAGAAAATGAGGGCATAGCGGTATT
GCCGATGCCCAGATCATCAGGTCCTCATGACCTTTAGGTCGGTTTCCTATATAAGCCTCT
TTCCTTTATTAATGTAGCCCCCCCCACAATGATCTTCATTGAATGAACTACAAGCtccaa
agtgaaaatattggttaaaaggcaagcccaaaccgaaactttgattataaaaggtggccc
aaagcatgaacttCGGTTGAAACTTTGATTATATATCTTGATTATATGG

CDS

1299 bp

>Os01t0818000-01 Auxin efflux carrier domain containing protein.
ATGATGGAGAGGTCGCTGATGGAGGCGCTGGCTACGGCGGCGCAGGGAGGCACCGTGGGG
ACGTCGGTTTTCGACATGCTCAAGTACGCCGTGCTGCCCATTGCCAAGGTGTTTACCGTC
TGTTTCATGGGGTTCCTCATGGCCTCTAAGTATGTCAATATCCTCCAGCCGAACGGCCGC
AAGCTTCTCAATGGGCTTGTGTTCTCGCTTCTACTTCCTTGCCTTATATTTTCCCAACTG
GGTAGAGCAATCACAATCGAAAAGATGCTGCAATGGTGGTATATTCCAGTAAATATTGTT
GTAGGTGCAGTGTCAGGCTCTTTGATTGGCTTTGTGGTGGCTTCTATCATCCGACCACCT
TATCCATACTTCAAGTTCACTGTGATTCACATTGGAATAGGGAATATTGGAAATATACCT
CTGGTTCTCATTGCAGCATTATGTCGAGATCCCACCAATCCTTTTGGTGACTCTGATAAA
TGTAATGAAGATGGGAATGCGTATATCTCATTTGGTCAATGGGTTGGTGCAATTATTGTT
TACACATATGTGTTCAAGATGCTTGCTCCACCACCTGGTGAATCCTTTGATAGCGCTGAA
GAAGATATTCTTCCAATTAAGGCATCTGGAGATAATGTGGTGCCTGAAAAAGGGAAATAT
CCAACAAGCACTCGCACTAGTACTGTACCTGAAAATGAGCCTTTGTTATCTTCTGAAGGT
GATAAAAATGTTTCTACTTCTCTAGGATCGAAGATAATGGGCATTGTTAGAAGCATGGTT
AAGTTCCTAAAAGACAAGCAGCTTCTTCAGCCACCAATTATTGCCTCTGTTTTTGCAATT
GCCATTGGTGTTGTTCCAGTCTTGAAGAATTTTGTCCTCACTGATGATGCACCTCTGTTC
TTCTTCACAGACAGCTGTCTCATTCTAGGGGAAGCAATGATCCCTTGCATTTTGCTTGCA
GTGGGGGGCAATCTTGTCGATGGTCCTGGTGAAGGAAGTAACAGGCTTGGTGTGCGGACA
ACCGTTGCTATTATTTTTGCACGGCTCATCTTGGTTCCTCTTGCTGGGGTTGGCATCATT
GTGTTGGTTGATAAACTTGGTTTCATTCCTAAAGATGACAAAATGTTCAAGTTTGTCTTG
CTACTGCAGCATTCTATGCCCACATCTGTGCTGTCAGGTGCTGTTGCAAACCTGAGGGGC
TGTGGAAAAGAATCTGCTGCTATCTTGTTCTGGGTGCACATCTTTGCTGTGTTCTCCATG
GCAGGATGGATTATTTTGTATTTGAGCTTACTCTTCTAA

Protein

433 aa

>Os01t0818000-01 Auxin efflux carrier domain containing protein.
MMERSLMEALATAAQGGTVGTSVFDMLKYAVLPIAKVFTVCFMGFLMASKYVNILQPNGR
KLLNGLVFSLLLPCLIFSQLGRAITIEKMLQWWYIPVNIVVGAVSGSLIGFVVASIIRPP
YPYFKFTVIHIGIGNIGNIPLVLIAALCRDPTNPFGDSDKCNEDGNAYISFGQWVGAIIV
YTYVFKMLAPPPGESFDSAEEDILPIKASGDNVVPEKGKYPTSTRTSTVPENEPLLSSEG
DKNVSTSLGSKIMGIVRSMVKFLKDKQLLQPPIIASVFAIAIGVVPVLKNFVLTDDAPLF
FFTDSCLILGEAMIPCILLAVGGNLVDGPGEGSNRLGVRTTVAIIFARLILVPLAGVGII
VLVDKLGFIPKDDKMFKFVLLLQHSMPTSVLSGAVANLRGCGKESAAILFWVHIFAVFSM
AGWIILYLSLLF*

5'UTR

chr01:34834574..34834695 (+ strand) : 122 bp

chr01:34835378..34835427 (+ strand) : 50 bp

CDS

chr01:34835428..34835622 (+ strand) : 195 bp

chr01:34835805..34835884 (+ strand) : 80 bp

chr01:34836337..34836461 (+ strand) : 125 bp

chr01:34836549..34836670 (+ strand) : 122 bp

chr01:34836812..34837042 (+ strand) : 231 bp

chr01:34837133..34837207 (+ strand) : 75 bp

chr01:34837301..34837401 (+ strand) : 101 bp

chr01:34837520..34837572 (+ strand) : 53 bp

chr01:34837690..34837884 (+ strand) : 195 bp

chr01:34838074..34838195 (+ strand) : 122 bp

3'UTR

chr01:34838196..34838210 (+ strand) : 15 bp

chr01:34838317..34838685 (+ strand) : 369 bp

chr01:34839008..34839121 (+ strand) : 114 bp

FASTA

>Os01t0818000-01 class=Sequence position=chr01:34834574..34839121 (+ strand)
ATCCGATAGC TTAATCTCGA GCGCTTCGAG TTCGATCTCT CGTGAAGGGG ACGACGAGGG CATTGTCTCC CTCCTCGCGC
GCGCGGAGTC GCCGCCGCCG CCGCCTCGTC CTCGGCCACG CGGTGAGTCC TCGCGCCGAC CTCGCCGTTT TGGTTGCGTT
TTTTTTTAGT TTTCTCTGCA GCGGGATTTG GAGACGATGG GTGTCGCTGT GTGTGCTGTG AAATGGGGAT TTGTGGTTTT
TTTTTTTGGT TTGTGGAGTA CGAGTACGCG GGGGAAGTTT CGAGGTCGGT TGCATCCGGA GCTCCCGCTG GAGTGGTCTA
CTCTAGTGCG GATTTGGAAG CGGAGAAGTT GGAGTTGGAG GTGGCGTGAC GGATCAAGCG GAGTCGCGAT CGCTCGCCGG
AGCCGTGCGG ATTCCGGTGC TAGCGAACAA CGGCGGCACC GTCGGCGTTT TGTAGCGGTC AAGCTGCTGC TGCTGCTCGG
AATCTAGCTA GGTTTTTGTT CTGTCCTAAT CCGGGTTTCC CGATTGGATT TGATGGTCTT CTCCCCACGC ATGAGAGTTG
GTTAGCACGG AAGCTTTGGG GATTGTTCCG TTTAATTCGG CGCGCTTGCT GAGTTGTGCG CGCTCACGCT GCGCTCCAGT
TGGCTAGGCC TGCGGGGGAG GCGATCTCTG TTCCGCTTTG GCGCTCTCTG GACAACCGAC TTCAAAAGCG GCTCCTGATT
TTTTTCCTGC TGTTGCTTGT ATATTTTGCC TTCTAAGTCA CTCATGTTGG CAGGAATTGC GTGGGTCCTG GTTGTGGAAG
TCAGGAAGTG AAGAAGAAGA AGAAGAAGTG AACTAGTGAA GCCTGGGGCA AGCCATGATG GAGAGGTCGC TGATGGAGGC
GCTGGCTACG GCGGCGCAGG GAGGCACCGT GGGGACGTCG GTTTTCGACA TGCTCAAGTA CGCCGTGCTG CCCATTGCCA
AGGTGTTTAC CGTCTGTTTC ATGGGGTTCC TCATGGCCTC TAAGTATGTC AATATCCTCC AGCCGAACGG CCGCAAGCTT
CTCAATGGGG TGAGCCTTGT TCATTCTCTT GCAATATAAT TTTATCTGTA AGATTTATGA GTTTTTGCTG TGACTATGGA
GAATGGTAAG TTGGCTGCTG TCTAGAATAG GAAGATGTGG GGGCAGTTGC TTGTGCTTAC TTGCATTCCT GATGTTCTCG
ATTATGCTTA CATTTTGGTC GTTTGGTGCA GCTTGTGTTC TCGCTTCTAC TTCCTTGCCT TATATTTTCC CAACTGGGTA
GAGCAATCAC AATCGAAAAG ATGCTGCAAT GGTAATGACA GATTCTAGTT AATATGCTTT GTTAAGTTTG CTGCATGCTT
TTCGCATTTC ATTGTGTAGT CTATTGATCA TGGTTCTTAC CATAACTAGA TCGTTCTGGT TGCGGGAATT TTAAGTCATC
ATCCAAATGG AGTAAATTAG CTCCCAGAAT TTTCTGCAAA AAGATCTTAA GTGTACCAAT CGAAAGCGAA GGAAGTGTTG
CATTATCTGA AAGTTTCAGG ACTAATTTAA GACGTCAAAA TACTTAAATT ACCATATTGT TTGTTACTGG CAAAATCCAT
CTGGTTGGAA TTGGTTGGAC TTCATCTATA AGGCCATCCA ATCCTTGTTA TTATTTATGA TGACATAAGG CCTTTTTCTT
TGCAAAAGAT AATCGCATTG TGCCTATGTT TTGCTTTTAC TGTTTTTAAC ATTCTTACAG TAGCAATATT TTGTTGTTTG
CAGGTGGTAT ATTCCAGTAA ATATTGTTGT AGGTGCAGTG TCAGGCTCTT TGATTGGCTT TGTGGTGGCT TCTATCATCC
GACCACCTTA TCCATACTTC AAGTTCACTG TGATTCACAT TGGAATAGGT ACCTGGTTTT CTTTATTAAA TAAAGTTGCC
TTCTCATTTA TCATTCTTCT ATTTTATATT GATCCGATCC CTTATTTCGA TTCAGGGAAT ATTGGAAATA TACCTCTGGT
TCTCATTGCA GCATTATGTC GAGATCCCAC CAATCCTTTT GGTGACTCTG ATAAATGTAA TGAAGATGGG AATGCGTATA
TCTCATTTGG TCAATGGGTA CATGTCTTTT CTTTTCTGAA GTTGCATGAG TTCATGCTTT ATTCAGGACC TCTACTATGC
AAAATAAATG TAACAGGTTG AATTTAGGTT AGGTATGCAT TGAGATCATT CACTCAGTGA ATCCTTTAAA TGTTTCAGGT
TGGTGCAATT ATTGTTTACA CATATGTGTT CAAGATGCTT GCTCCACCAC CTGGTGAATC CTTTGATAGC GCTGAAGAAG
ATATTCTTCC AATTAAGGCA TCTGGAGATA ATGTGGTGCC TGAAAAAGGG AAATATCCAA CAAGCACTCG CACTAGTACT
GTACCTGAAA ATGAGCCTTT GTTATCTTCT GAAGGTGATA AAAATGTTTC TACTTCTCTA GGATCGAAGG TGAGAAATAC
CATCAGAAAT TTGGTATGTT TACTTCTTAT ATCAATTTGA TTTCTAACAT GAGCTAAAAA TCATGCTCTG TTGATGCAGA
TAATGGGCAT TGTTAGAAGC ATGGTTAAGT TCCTAAAAGA CAAGCAGCTT CTTCAGCCAC CAATTATTGC CTCTGTATGT
ATCTACACTA CAATATTATG CTAGCAATAA ACACAGAACA TTTCTGTATA CTGTGGTTTG ACAGCAACTA TTTTACACTA
TGCACAGGTT TTTGCAATTG CCATTGGTGT TGTTCCAGTC TTGAAGAATT TTGTCCTCAC TGATGATGCA CCTCTGTTCT
TCTTCACAGA CAGCTGTCTC ATTCTAGGGT ATTTACATGA CTTTCAGTTC CCTTTTTGTA AAATAAAGTA CACTTTCCTA
TAAAATTACA AAAGCACGAT GAGCCACCTT GGTTCCTAGT TTCTAATTCT GTCATTCCTT TTTCAGGGAA GCAATGATCC
CTTGCATTTT GCTTGCAGTG GGGGGCAATC TTGTCGATGG TAAGCACCTA GTTCTGTTGA AACTATTGCG CGGCTCCTAC
CATTCTATAG TACTAGGAGC CTAGGATGCA TCTCCAGATC TTATCCTAGC TCATGTAACC ATGTTTATTG CATCAGGTCC
TGGTGAAGGA AGTAACAGGC TTGGTGTGCG GACAACCGTT GCTATTATTT TTGCACGGCT CATCTTGGTT CCTCTTGCTG
GGGTTGGCAT CATTGTGTTG GTTGATAAAC TTGGTTTCAT TCCTAAAGAT GACAAAATGT TCAAGTTTGT CTTGCTACTG
CAGCATTCTA TGCCCACATC TGTGCTGTCA GGTACTAAGA AATGAATAAG GGACACTACT TATCACTTAT TATCATGTGA
GCATGTTCAA AGATAGATTC CTTCTAATAG TTTTATGTGT TGGTTGAGAT CTGTAAGGCA TTGGTGGTGG AACACCATGT
GCTTTATGTT AGCGACCAAA TAATGGAATA TGATCTGAGT TTTTTTTTTT TTTTTGGCAG GTGCTGTTGC AAACCTGAGG
GGCTGTGGAA AAGAATCTGC TGCTATCTTG TTCTGGGTGC ACATCTTTGC TGTGTTCTCC ATGGCAGGAT GGATTATTTT
GTATTTGAGC TTACTCTTCT AAGTACGTCA TACCCTGGTA ATGGCAGTTA ATCTGTGGCA TTTGTGCTCA AGTTGCAGCT
CTACAGATTA ACTACTATAC GAGTCCTTGA ATACTTAGAG CCACTCTCTG ATTTGATTTG CAGATGCTAT ACTGCACAGG
AACGTCCATA AGATCAAAAT ATCACCAGAT ATACCAGAAA AAGATAGTAC CATGACATGT ACATTAGCCA GTAAACCATG
GCGACAGCCT GAAGGTACGA GTTGTATCAG TATTCAGTAT AGATATGGTT CTCCTGCCCA GTGCCCAATC GCTTAAGCGC
CACTGCTATG TTAATTTTGC TAATCGCTCG CTGCTACAAG CAACTGAGCA ATGAGAAAAT GAGGGCATAG CGGTATTGCC
GATGCCCAGA TCATCAGGTC CTCATGACCT TTAGGTCGGT TTCCTATATA AGCCTCTTTC CTTTATTAAT GTAGCCCCCC
CCACAATGAT CTTCATTGAA TGAACTACAA GCTTCAAGTG TGTTTTTGTG GTGCAGTTAT ATTTGAAAGA GTAAgagtaa
actacaaatt ggaccactgt ttattggcaa agttttgctt tgggcctccc tttaaccaat gttttcactt tggactagat
aattatactt gtgtcacttt ggatcacccc taactcttat gttaagtaca tcaataatct cgattatacc ggcttttgca
tgccgatgaa ctcgtgaaat tgtatgtaga ccacaccttt ggcacagaat gagttggatg taaatggata agagttgaga
gttgtccaag tgacacaaat aaaaaattat ctagtccaaa gtgaaaatat tggttaaaag gcaagcccaa accgaaactt
tgattataaa aggtggccca aagcatgaac ttCGGTTGAA ACTTTGATTA TATATCTTGA TTATATGG

Locus: Os01g0818000

Loading...

Locus: Os01g0818000

Loading...