Os01t0818000-02

Locus

Os01g0818000

Description

Auxin efflux carrier domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS6a, PILS6a

Oryzabase Gene Name Synonym(s)

PIN likes 6a

Transcript Evidence

AK070194 (DDBJ, Best hit)

Protein Evidence

XP_002870888.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Auxin efflux carrier (IPR004776)

Full-length cDNA

J023041H12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0818000-02)

RiceXPro (AK070194)

Others

Oryzabase (19848)

KEGG (Os01t0818000-02)

Transcript

1929 bp

>Os01t0818000-02 Auxin efflux carrier domain containing protein.
AGCTTAATCTCGAGCGCTTCGAGTTCGATCTCTCGTGAAGGGGACGACGAGGGCATTGTC
TCCCTCCTCGCGCGCGCGGAGTCGCCGCCGCCGCCGCCTCGTCCTCGGCCACGCGGAATT
GCGTGGGTCCTGGTTGTGGAAGTCAGGAAGTGAAGAAGAAGAAGAAGAAGTGAACTAGTG
AAGCCTGGGGCAAGCCATGATGGAGAGGTCGCTGATGGAGGCGCTGGCTACGGCGGCGCA
GGGAGGCACCGTGGGGACGTCGGTTTTCGACATGCTCAAGTACGCCGTGCTGCCCATTGC
CAAGGTGTTTACCGTCTGTTTCATGGGGTTCCTCATGGCCTCTAAGTATGTCAATATCCT
CCAGCCGAACGGCCGCAAGCTTCTCAATGGGCTTGTGTTCTCGCTTCTACTTCCTTGCCT
TATATTTTCCCAACTGGGTAGAGCAATCACAATCGAAAAGATGCTGCAATGGTGGTATAT
TCCAGTAAATATTGTTGTAGGTGCAGTGTCAGGCTCTTTGATTGGCTTTGTGGTGGCTTC
TATCATCCGACCACCTTATCCATACTTCAAGTTCACTGTGATTCACATTGGAATAGGGAA
TATTGGAAATATACCTCTGGTTCTCATTGCAGCATTATGTCGAGATCCCACCAATCCTTT
TGGTGACTCTGATAAATGTAATGAAGATGGGAATGCGTATATCTCATTTGGTCAATGGGT
TGGTGCAATTATTGTTTACACATATGTGTTCAAGATGCTTGCTCCACCACCTGGTGAATC
CTTTGATAGCGCTGAAGAAGATATTCTTCCAATTAAGGCATCTGGAGATAATGTGGTGCC
TGAAAAAGGGAAATATCCAACAAGCACTCGCACTAGTACTGTACCTGAAAATGAGCCTTT
GTTATCTTCTGAAGGTGATAAAAATGTTTCTACTTCTCTAGGATCGAAGATAATGGGCAT
TGTTAGAAGCATGGTTAAGTTCCTAAAAGACAAGCAGCTTCTTCAGCCACCAATTATTGC
CTCTGTTTTTGCAATTGCCATTGGTGTTGTTCCAGTCTTGAAGAATTTTGTCCTCACTGA
TGATGCACCTCTGTTCTTCTTCACAGACAGCTGTCTCATTCTAGGGGAAGCAATGATCCC
TTGCATTTTGCTTGCAGTGGGGGGCAATCTTGTCGATGGTCCTGGTGAAGGAAGTAACAG
GCTTGGTGTGCGGACAACCGTTGCTATTATTTTTGCACGGCTCATCTTGGTTCCTCTTGC
TGGGGTTGGCATCATTGTGTTGGTTGATAAACTTGGTTTCATTCCTAAAGATGACAAAAT
GTTCAAGTTTGTCTTGCTACTGCAGCATTCTATGCCCACATCTGTGCTGTCAGGTGCTGT
TGCAAACCTGAGGGGCTGTGGAAAAGAATCTGCTGCTATCTTGTTCTGGGTGCACATCTT
TGCTGTGTTCTCCATGGCAGGATGGATTATTTTGTATTTGAGCTTACTCTTCTAAGTACG
TCATACCCTGATGCTATACTGCACAGGAACGTCCATAAGATCAAAATATCACCAGATATA
CCAGAAAAAGATAGTACCATGACATGTACATTAGCCAGTAAACCATGGCGACAGCCTGAA
GGATGGGTGCCCGACATCCACCCACGCACATACATGAATGCCAAAATCAAAATATTTGCC
TGCAAGCTCATGCCAGCGGTTCCTAGTATGCATGTGGGTCATGTAGCCTTAACTAGCATT
GGTACTTCCAGATCCAGTGATATCAGAGTACATATGTGATCTCTCCATGTGCTTATAGAT
CTGGGAACCTGCAGATCTGAAGTTCTGAACCCACAGTTTTCATTCACTTTTAATCTTTTG
AATCTGAAGGAGAGGGAGATTCATGATTCATCACCGTACCAAAAAAAAAGGTGAGAGATT
TCTATAGTG

CDS

1299 bp

>Os01t0818000-02 Auxin efflux carrier domain containing protein.
ATGATGGAGAGGTCGCTGATGGAGGCGCTGGCTACGGCGGCGCAGGGAGGCACCGTGGGG
ACGTCGGTTTTCGACATGCTCAAGTACGCCGTGCTGCCCATTGCCAAGGTGTTTACCGTC
TGTTTCATGGGGTTCCTCATGGCCTCTAAGTATGTCAATATCCTCCAGCCGAACGGCCGC
AAGCTTCTCAATGGGCTTGTGTTCTCGCTTCTACTTCCTTGCCTTATATTTTCCCAACTG
GGTAGAGCAATCACAATCGAAAAGATGCTGCAATGGTGGTATATTCCAGTAAATATTGTT
GTAGGTGCAGTGTCAGGCTCTTTGATTGGCTTTGTGGTGGCTTCTATCATCCGACCACCT
TATCCATACTTCAAGTTCACTGTGATTCACATTGGAATAGGGAATATTGGAAATATACCT
CTGGTTCTCATTGCAGCATTATGTCGAGATCCCACCAATCCTTTTGGTGACTCTGATAAA
TGTAATGAAGATGGGAATGCGTATATCTCATTTGGTCAATGGGTTGGTGCAATTATTGTT
TACACATATGTGTTCAAGATGCTTGCTCCACCACCTGGTGAATCCTTTGATAGCGCTGAA
GAAGATATTCTTCCAATTAAGGCATCTGGAGATAATGTGGTGCCTGAAAAAGGGAAATAT
CCAACAAGCACTCGCACTAGTACTGTACCTGAAAATGAGCCTTTGTTATCTTCTGAAGGT
GATAAAAATGTTTCTACTTCTCTAGGATCGAAGATAATGGGCATTGTTAGAAGCATGGTT
AAGTTCCTAAAAGACAAGCAGCTTCTTCAGCCACCAATTATTGCCTCTGTTTTTGCAATT
GCCATTGGTGTTGTTCCAGTCTTGAAGAATTTTGTCCTCACTGATGATGCACCTCTGTTC
TTCTTCACAGACAGCTGTCTCATTCTAGGGGAAGCAATGATCCCTTGCATTTTGCTTGCA
GTGGGGGGCAATCTTGTCGATGGTCCTGGTGAAGGAAGTAACAGGCTTGGTGTGCGGACA
ACCGTTGCTATTATTTTTGCACGGCTCATCTTGGTTCCTCTTGCTGGGGTTGGCATCATT
GTGTTGGTTGATAAACTTGGTTTCATTCCTAAAGATGACAAAATGTTCAAGTTTGTCTTG
CTACTGCAGCATTCTATGCCCACATCTGTGCTGTCAGGTGCTGTTGCAAACCTGAGGGGC
TGTGGAAAAGAATCTGCTGCTATCTTGTTCTGGGTGCACATCTTTGCTGTGTTCTCCATG
GCAGGATGGATTATTTTGTATTTGAGCTTACTCTTCTAA

Protein

433 aa

>Os01t0818000-02 Auxin efflux carrier domain containing protein.
MMERSLMEALATAAQGGTVGTSVFDMLKYAVLPIAKVFTVCFMGFLMASKYVNILQPNGR
KLLNGLVFSLLLPCLIFSQLGRAITIEKMLQWWYIPVNIVVGAVSGSLIGFVVASIIRPP
YPYFKFTVIHIGIGNIGNIPLVLIAALCRDPTNPFGDSDKCNEDGNAYISFGQWVGAIIV
YTYVFKMLAPPPGESFDSAEEDILPIKASGDNVVPEKGKYPTSTRTSTVPENEPLLSSEG
DKNVSTSLGSKIMGIVRSMVKFLKDKQLLQPPIIASVFAIAIGVVPVLKNFVLTDDAPLF
FFTDSCLILGEAMIPCILLAVGGNLVDGPGEGSNRLGVRTTVAIIFARLILVPLAGVGII
VLVDKLGFIPKDDKMFKFVLLLQHSMPTSVLSGAVANLRGCGKESAAILFWVHIFAVFSM
AGWIILYLSLLF*

5'UTR

chr01:34834581..34834695 (+ strand) : 115 bp

chr01:34835347..34835427 (+ strand) : 81 bp

CDS

chr01:34835428..34835622 (+ strand) : 195 bp

chr01:34835805..34835884 (+ strand) : 80 bp

chr01:34836337..34836461 (+ strand) : 125 bp

chr01:34836549..34836670 (+ strand) : 122 bp

chr01:34836812..34837042 (+ strand) : 231 bp

chr01:34837133..34837207 (+ strand) : 75 bp

chr01:34837301..34837401 (+ strand) : 101 bp

chr01:34837520..34837572 (+ strand) : 53 bp

chr01:34837690..34837884 (+ strand) : 195 bp

chr01:34838074..34838195 (+ strand) : 122 bp

3'UTR

chr01:34838196..34838210 (+ strand) : 15 bp

chr01:34838317..34838427 (+ strand) : 111 bp

chr01:34839197..34839504 (+ strand) : 308 bp

FASTA

>Os01t0818000-02 class=Sequence position=chr01:34834581..34839504 (+ strand)
AGCTTAATCT CGAGCGCTTC GAGTTCGATC TCTCGTGAAG GGGACGACGA GGGCATTGTC TCCCTCCTCG CGCGCGCGGA
GTCGCCGCCG CCGCCGCCTC GTCCTCGGCC ACGCGGTGAG TCCTCGCGCC GACCTCGCCG TTTTGGTTGC GTTTTTTTTT
AGTTTTCTCT GCAGCGGGAT TTGGAGACGA TGGGTGTCGC TGTGTGTGCT GTGAAATGGG GATTTGTGGT TTTTTTTTTT
GGTTTGTGGA GTACGAGTAC GCGGGGGAAG TTTCGAGGTC GGTTGCATCC GGAGCTCCCG CTGGAGTGGT CTACTCTAGT
GCGGATTTGG AAGCGGAGAA GTTGGAGTTG GAGGTGGCGT GACGGATCAA GCGGAGTCGC GATCGCTCGC CGGAGCCGTG
CGGATTCCGG TGCTAGCGAA CAACGGCGGC ACCGTCGGCG TTTTGTAGCG GTCAAGCTGC TGCTGCTGCT CGGAATCTAG
CTAGGTTTTT GTTCTGTCCT AATCCGGGTT TCCCGATTGG ATTTGATGGT CTTCTCCCCA CGCATGAGAG TTGGTTAGCA
CGGAAGCTTT GGGGATTGTT CCGTTTAATT CGGCGCGCTT GCTGAGTTGT GCGCGCTCAC GCTGCGCTCC AGTTGGCTAG
GCCTGCGGGG GAGGCGATCT CTGTTCCGCT TTGGCGCTCT CTGGACAACC GACTTCAAAA GCGGCTCCTG ATTTTTTTCC
TGCTGTTGCT TGTATATTTT GCCTTCTAAG TCACTCATGT TGGCAGGAAT TGCGTGGGTC CTGGTTGTGG AAGTCAGGAA
GTGAAGAAGA AGAAGAAGAA GTGAACTAGT GAAGCCTGGG GCAAGCCATG ATGGAGAGGT CGCTGATGGA GGCGCTGGCT
ACGGCGGCGC AGGGAGGCAC CGTGGGGACG TCGGTTTTCG ACATGCTCAA GTACGCCGTG CTGCCCATTG CCAAGGTGTT
TACCGTCTGT TTCATGGGGT TCCTCATGGC CTCTAAGTAT GTCAATATCC TCCAGCCGAA CGGCCGCAAG CTTCTCAATG
GGGTGAGCCT TGTTCATTCT CTTGCAATAT AATTTTATCT GTAAGATTTA TGAGTTTTTG CTGTGACTAT GGAGAATGGT
AAGTTGGCTG CTGTCTAGAA TAGGAAGATG TGGGGGCAGT TGCTTGTGCT TACTTGCATT CCTGATGTTC TCGATTATGC
TTACATTTTG GTCGTTTGGT GCAGCTTGTG TTCTCGCTTC TACTTCCTTG CCTTATATTT TCCCAACTGG GTAGAGCAAT
CACAATCGAA AAGATGCTGC AATGGTAATG ACAGATTCTA GTTAATATGC TTTGTTAAGT TTGCTGCATG CTTTTCGCAT
TTCATTGTGT AGTCTATTGA TCATGGTTCT TACCATAACT AGATCGTTCT GGTTGCGGGA ATTTTAAGTC ATCATCCAAA
TGGAGTAAAT TAGCTCCCAG AATTTTCTGC AAAAAGATCT TAAGTGTACC AATCGAAAGC GAAGGAAGTG TTGCATTATC
TGAAAGTTTC AGGACTAATT TAAGACGTCA AAATACTTAA ATTACCATAT TGTTTGTTAC TGGCAAAATC CATCTGGTTG
GAATTGGTTG GACTTCATCT ATAAGGCCAT CCAATCCTTG TTATTATTTA TGATGACATA AGGCCTTTTT CTTTGCAAAA
GATAATCGCA TTGTGCCTAT GTTTTGCTTT TACTGTTTTT AACATTCTTA CAGTAGCAAT ATTTTGTTGT TTGCAGGTGG
TATATTCCAG TAAATATTGT TGTAGGTGCA GTGTCAGGCT CTTTGATTGG CTTTGTGGTG GCTTCTATCA TCCGACCACC
TTATCCATAC TTCAAGTTCA CTGTGATTCA CATTGGAATA GGTACCTGGT TTTCTTTATT AAATAAAGTT GCCTTCTCAT
TTATCATTCT TCTATTTTAT ATTGATCCGA TCCCTTATTT CGATTCAGGG AATATTGGAA ATATACCTCT GGTTCTCATT
GCAGCATTAT GTCGAGATCC CACCAATCCT TTTGGTGACT CTGATAAATG TAATGAAGAT GGGAATGCGT ATATCTCATT
TGGTCAATGG GTACATGTCT TTTCTTTTCT GAAGTTGCAT GAGTTCATGC TTTATTCAGG ACCTCTACTA TGCAAAATAA
ATGTAACAGG TTGAATTTAG GTTAGGTATG CATTGAGATC ATTCACTCAG TGAATCCTTT AAATGTTTCA GGTTGGTGCA
ATTATTGTTT ACACATATGT GTTCAAGATG CTTGCTCCAC CACCTGGTGA ATCCTTTGAT AGCGCTGAAG AAGATATTCT
TCCAATTAAG GCATCTGGAG ATAATGTGGT GCCTGAAAAA GGGAAATATC CAACAAGCAC TCGCACTAGT ACTGTACCTG
AAAATGAGCC TTTGTTATCT TCTGAAGGTG ATAAAAATGT TTCTACTTCT CTAGGATCGA AGGTGAGAAA TACCATCAGA
AATTTGGTAT GTTTACTTCT TATATCAATT TGATTTCTAA CATGAGCTAA AAATCATGCT CTGTTGATGC AGATAATGGG
CATTGTTAGA AGCATGGTTA AGTTCCTAAA AGACAAGCAG CTTCTTCAGC CACCAATTAT TGCCTCTGTA TGTATCTACA
CTACAATATT ATGCTAGCAA TAAACACAGA ACATTTCTGT ATACTGTGGT TTGACAGCAA CTATTTTACA CTATGCACAG
GTTTTTGCAA TTGCCATTGG TGTTGTTCCA GTCTTGAAGA ATTTTGTCCT CACTGATGAT GCACCTCTGT TCTTCTTCAC
AGACAGCTGT CTCATTCTAG GGTATTTACA TGACTTTCAG TTCCCTTTTT GTAAAATAAA GTACACTTTC CTATAAAATT
ACAAAAGCAC GATGAGCCAC CTTGGTTCCT AGTTTCTAAT TCTGTCATTC CTTTTTCAGG GAAGCAATGA TCCCTTGCAT
TTTGCTTGCA GTGGGGGGCA ATCTTGTCGA TGGTAAGCAC CTAGTTCTGT TGAAACTATT GCGCGGCTCC TACCATTCTA
TAGTACTAGG AGCCTAGGAT GCATCTCCAG ATCTTATCCT AGCTCATGTA ACCATGTTTA TTGCATCAGG TCCTGGTGAA
GGAAGTAACA GGCTTGGTGT GCGGACAACC GTTGCTATTA TTTTTGCACG GCTCATCTTG GTTCCTCTTG CTGGGGTTGG
CATCATTGTG TTGGTTGATA AACTTGGTTT CATTCCTAAA GATGACAAAA TGTTCAAGTT TGTCTTGCTA CTGCAGCATT
CTATGCCCAC ATCTGTGCTG TCAGGTACTA AGAAATGAAT AAGGGACACT ACTTATCACT TATTATCATG TGAGCATGTT
CAAAGATAGA TTCCTTCTAA TAGTTTTATG TGTTGGTTGA GATCTGTAAG GCATTGGTGG TGGAACACCA TGTGCTTTAT
GTTAGCGACC AAATAATGGA ATATGATCTG AGTTTTTTTT TTTTTTTTGG CAGGTGCTGT TGCAAACCTG AGGGGCTGTG
GAAAAGAATC TGCTGCTATC TTGTTCTGGG TGCACATCTT TGCTGTGTTC TCCATGGCAG GATGGATTAT TTTGTATTTG
AGCTTACTCT TCTAAGTACG TCATACCCTG GTAATGGCAG TTAATCTGTG GCATTTGTGC TCAAGTTGCA GCTCTACAGA
TTAACTACTA TACGAGTCCT TGAATACTTA GAGCCACTCT CTGATTTGAT TTGCAGATGC TATACTGCAC AGGAACGTCC
ATAAGATCAA AATATCACCA GATATACCAG AAAAAGATAG TACCATGACA TGTACATTAG CCAGTAAACC ATGGCGACAG
CCTGAAGGTA CGAGTTGTAT CAGTATTCAG TATAGATATG GTTCTCCTGC CCAGTGCCCA ATCGCTTAAG CGCCACTGCT
ATGTTAATTT TGCTAATCGC TCGCTGCTAC AAGCAACTGA GCAATGAGAA AATGAGGGCA TAGCGGTATT GCCGATGCCC
AGATCATCAG GTCCTCATGA CCTTTAGGTC GGTTTCCTAT ATAAGCCTCT TTCCTTTATT AATGTAGCCC CCCCCACAAT
GATCTTCATT GAATGAACTA CAAGCTTCAA GTGTGTTTTT GTGGTGCAGT TATATTTGAA AGAGTAAgag taaactacaa
attggaccac tgtttattgg caaagttttg ctttgggcct ccctttaacc aatgttttca ctttggacta gataattata
cttgtgtcac tttggatcac ccctaactct tatgttaagt acatcaataa tctcgattat accggctttt gcatgccgat
gaactcgtga aattgtatgt agaccacacc tttggcacag aatgagttgg atgtaaatgg ataagagttg agagttgtcc
aagtgacaca aataaaaaat tatctagtcc aaagtgaaaa tattggttaa aaggcaagcc caaaccgaaa ctttgattat
aaaaggtggc ccaaagcatg aacttCGGTT GAAACTTTGA TTATATATCT TGATTATATG GATACAATCT CTCATGCATG
AACTGATGCG TGCACATGCA TAATGTTTAT GTGATCACAT GATTCGCATC ATGCAGGATG GGTGCCCGAC ATCCACCCAC
GCACATACAT GAATGCCAAA ATCAAAATAT TTGCCTGCAA GCTCATGCCA GCGGTTCCTA GTATGCATGT GGGTCATGTA
GCCTTAACTA GCATTGGTAC TTCCAGATCC AGTGATATCA GAGTACATAT GTGATCTCTC CATGTGCTTA TAGATCTGGG
AACCTGCAGA TCTGAAGTTC TGAACCCACA GTTTTCATTC ACTTTTAATC TTTTGAATCT GAAGGAGAGG GAGATTCATG
ATTCATCACC GTACCAAAAA AAAAGGTGAG AGATTTCTAT AGTG

Locus: Os01g0818000

Loading...

Locus: Os01g0818000

Loading...