Os01t0819400-00

Locus

Os01g0819400

Description

Similar to Ubiquitin carrier protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC23

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 23

Oryzabase Gene Symbol Synonym(s)

OsUBC23

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 23

Transcript Evidence

FP101418 (DDBJ)

Protein Evidence

B8ABB5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Expression Databases

TENOR (Os01t0819400-00)

Others

Oryzabase (19564)

KEGG (Os01t0819400-00 (EC:6.3.2.19))

Transcript

705 bp

>Os01t0819400-00 Similar to Ubiquitin carrier protein.
ATGCTAATGCAATTTAAGCAGGAGCTTATCATGGCGTCGAAGCGGATCCTCAAGGAACTA
AAGGACCTGCAGAAAGATCCTCCAACATCATGCAGTGCAGGTCCTGCTGGTGAGGATATG
TTCCATTGGCAGGCAACCATTATGGGCCCTCCAGATAGTCCCTATGCTGGTGGTGTTTTC
TTGGTGAATATTCATTTCCCCCCGGACTACCCCTTCAAACCTCCAAAGGTGTCTTTTAAG
ACAAAGGTCTTCCATCCAAACATCAATAGCAATGGAAGCATATGCCTCGACATTCTTAAG
GAACAGTGGAGCCCTGCTTTGACAATATCTAAGGTCTTGCTTTCGATCTGCTCGCTGCTC
ACTGACCCCAACCCGGACGACCCTCTTGTCCCTGAGATTGCCCACATGTACAAGACGGAC
CGTCCAAAGTATGAGACGACAGCCCGCAGCTGGACCCAGAAGTATGCCATGGGATGAAAC
CCCAAGTCCTGAATTCGAATCCACTGCTTAAATGCAGACAAATTTGTCCCAAGAAACTGT
TTATGGGCCATTATTTTCTCCGATTCCTTGCCAGTCGTGTTGTGTCAGATCCATCTAGGA
TCGTGTCTCGTAGCCCCGACATCAACATATGATCATCGTCCGTCGATAATGAGATAACAT
ATGCTTGCCCGTGATAATTATGATATGGTGGTGGTGATGTTATTT

CDS

477 bp

>Os01t0819400-00 Similar to Ubiquitin carrier protein.
ATGCTAATGCAATTTAAGCAGGAGCTTATCATGGCGTCGAAGCGGATCCTCAAGGAACTA
AAGGACCTGCAGAAAGATCCTCCAACATCATGCAGTGCAGGTCCTGCTGGTGAGGATATG
TTCCATTGGCAGGCAACCATTATGGGCCCTCCAGATAGTCCCTATGCTGGTGGTGTTTTC
TTGGTGAATATTCATTTCCCCCCGGACTACCCCTTCAAACCTCCAAAGGTGTCTTTTAAG
ACAAAGGTCTTCCATCCAAACATCAATAGCAATGGAAGCATATGCCTCGACATTCTTAAG
GAACAGTGGAGCCCTGCTTTGACAATATCTAAGGTCTTGCTTTCGATCTGCTCGCTGCTC
ACTGACCCCAACCCGGACGACCCTCTTGTCCCTGAGATTGCCCACATGTACAAGACGGAC
CGTCCAAAGTATGAGACGACAGCCCGCAGCTGGACCCAGAAGTATGCCATGGGATGA

Protein

159 aa

>Os01t0819400-00 Similar to Ubiquitin carrier protein.
MLMQFKQELIMASKRILKELKDLQKDPPTSCSAGPAGEDMFHWQATIMGPPDSPYAGGVF
LVNIHFPPDYPFKPPKVSFKTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLL
TDPNPDDPLVPEIAHMYKTDRPKYETTARSWTQKYAMG*

CDS

chr01:34917652..34917751 (+ strand) : 100 bp

chr01:34918352..34918479 (+ strand) : 128 bp

chr01:34918766..34918870 (+ strand) : 105 bp

chr01:34919266..34919409 (+ strand) : 144 bp

3'UTR

chr01:34919410..34919637 (+ strand) : 228 bp

FASTA

>Os01t0819400-00 class=Sequence position=chr01:34917652..34919637 (+ strand)
ATGCTAATGC AATTTAAGCA GGAGCTTATC ATGGCGTCGA AGCGGATCCT CAAGGAACTA AAGGACCTGC AGAAAGATCC
TCCAACATCA TGCAGTGCAG GTATGACCCA GATTTATCAG CCGAACTATA GCTGTTAGAC ACAGTGTAAA CTTGAGCGTT
GATATGATAA TTGTACTCTG TGGGTGGTAG TCCTCATGTT CTTGTCGGAT GGAATTGTAC GAACTGTTTG TATCCTTTAG
TAGTGAAATC ATCCAATGGT GTGGTTATCC GTAAATTAAT TTTGATGAAT ATATTTTGGG TGGTGAGTTG TTTGTCAGAT
TGTATTCCAT GTTGTTCAAT TGGTCCACAT TGAAAGTGGA CTATCGGTGT CCTACATGTA AACAATTTCA CCCAGTATTC
TTGCTACAAG AAAATGCATA ATTCTGTCAG TTGTTGTCAT GATGATGCCC TTGTGTTTTC ATCTAGACAG CTGTGATGTT
TATAATTTTG AAGAAACGCT TCTAAGACAG AGCATCCTAA TGTATTTACA TTTTATATTG AAAATCTTGA TGAAATATGG
ACAATTATTA ACCAGTGCAA TTGATCATCT ATTCTCATGT AAACAATGAA TTGTTTTGGT CAGTTTGGTC TTGCGTACCT
TTTTGCCCTT TGCTTGTACA AGCTCTGGTG TTGATGAACT ATAGATTTTT ATAAATTTAG GTCCTGCTGG TGAGGATATG
TTCCATTGGC AGGCAACCAT TATGGGCCCT CCAGATAGTC CCTATGCTGG TGGTGTTTTC TTGGTGAATA TTCATTTCCC
CCCGGACTAC CCCTTCAAAC CTCCAAAGGT TAGCAGCGAG CCTTATTCTG GGGCAAAATT TTCCAATATT TGCCACTTCT
ATTGAAGATG AATCATGTGG CTATTGTTCC CTCTCCCTAT CTCATGGATG GATTGCTACT ACTTTTAATG GATCTTTATT
TCACAATCAT TTACTGTCTT CACTCAGTAT CATAATTCAT AAATGATCTA CAATATTAGT GAATCTTTAG CTCAATAGAT
TGGTTCACTA AGTCTACTGT CTACCTAGTG GTGGATTCCT TCTGCTATGC ATTAAGTTAG CTCCTTTTTT TCAGGTGTCT
TTTAAGACAA AGGTCTTCCA TCCAAACATC AATAGCAATG GAAGCATATG CCTCGACATT CTTAAGGAAC AGTGGAGCCC
TGCTTTGACA ATATCTAAGG TGCTTTGATG AAACTTCACT AAACTTCACT ACCTATagga aagcacattg aattccgcat
gcacgcttcc caaaatacta aatggtgtat tttttgcaaa aattttctat aggaaagttg ctttaaaaaa tcatattaat
ccatttttga aatttaaaat agttaatact caattaatca tacgctaatg acttatctcg ttttgcgtat cttcccaatc
tcctcaatcc ccttctcctc aaactcgccc tAAATGAATG CATATTTTCC TTCTTTATGA ACTTTGGCGA ATTGCATTGA
TTCATCTCAT ACACAATCTA GATAACAAGA GAGTGCGCTG TCTGTTCAAA GTGACTGCAT ATGTGGCGCT AACATTTGGG
TTTGTTTGTT TTAGGTCTTG CTTTCGATCT GCTCGCTGCT CACTGACCCC AACCCGGACG ACCCTCTTGT CCCTGAGATT
GCCCACATGT ACAAGACGGA CCGTCCAAAG TATGAGACGA CAGCCCGCAG CTGGACCCAG AAGTATGCCA TGGGATGAAA
CCCCAAGTCC TGAATTCGAA TCCACTGCTT AAATGCAGAC AAATTTGTCC CAAGAAACTG TTTATGGGCC ATTATTTTCT
CCGATTCCTT GCCAGTCGTG TTGTGTCAGA TCCATCTAGG ATCGTGTCTC GTAGCCCCGA CATCAACATA TGATCATCGT
CCGTCGATAA TGAGATAACA TATGCTTGCC CGTGATAATT ATGATATGGT GGTGGTGATG TTATTT

Locus: Os01g0819400

Loading...

Locus: Os01g0819400

Loading...