Os01t0819500-01

Locus

Os01g0819500

Description

Similar to Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19) (Ubiquitin- protein ligase 11) (Ubiquitin carrier protein 11).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC22

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 22

Oryzabase Gene Symbol Synonym(s)

OsUBC22

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 22

Transcript Evidence

AK058360 (DDBJ, Best hit)

Protein Evidence

B8ABB5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Full-length cDNA

001-014-F04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0819500-01)

RiceXPro (AK058360)

Others

Oryzabase (19563)

KEGG (Os01t0819500-01 (EC:6.3.2.19))

Transcript

354 bp

>Os01t0819500-01 Similar to Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19) (Ubiquitin- protein ligase 11) (Ubiquitin carrier protein 11).
AGGTGTTGCTTTCGATCTGCTCGCTGCTCACTGACCCCAACCCGGACGACCCTCTTGTCC
CTGAGATTGCCCACATGTACAAGACGGATCGTCCAAAGTATGAGACGACAGCCCGCAGCT
GGACCCAGAAGTATGCCATGGGATGATGAAACCCACAAGCCCTGAATTCAAACCTGCTGC
TTAAATGCAGACAGTCGTGGTAATTGTCCCAAGAAACTGTTTATGGGCCATTATTTCCTC
CGATTTGTTGCTGCCAGTCGTGTGTGTCAGATCCATGTAGCATCGTGTCTCGTAGCCCCA
ACATCAACATATGATCATTGCCCGTCGATAATGAGATAACATATGCTTGCCGTG

CDS

144 bp

>Os01t0819500-01 Similar to Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19) (Ubiquitin- protein ligase 11) (Ubiquitin carrier protein 11).
GTGTTGCTTTCGATCTGCTCGCTGCTCACTGACCCCAACCCGGACGACCCTCTTGTCCCT
GAGATTGCCCACATGTACAAGACGGATCGTCCAAAGTATGAGACGACAGCCCGCAGCTGG
ACCCAGAAGTATGCCATGGGATGA

Protein

48 aa

>Os01t0819500-01 Similar to Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19) (Ubiquitin- protein ligase 11) (Ubiquitin carrier protein 11).
VLLSICSLLTDPNPDDPLVPEIAHMYKTDRPKYETTARSWTQKYAMG*

5'UTR

chr01:34941447..34941448 (+ strand) : 2 bp

CDS

chr01:34941449..34941592 (+ strand) : 144 bp

3'UTR

chr01:34941593..34941800 (+ strand) : 208 bp

FASTA

>Os01t0819500-01 class=Sequence position=chr01:34941447..34941800 (+ strand)
AGGTGTTGCT TTCGATCTGC TCGCTGCTCA CTGACCCCAA CCCGGACGAC CCTCTTGTCC CTGAGATTGC CCACATGTAC
AAGACGGATC GTCCAAAGTA TGAGACGACA GCCCGCAGCT GGACCCAGAA GTATGCCATG GGATGATGAA ACCCACAAGC
CCTGAATTCA AACCTGCTGC TTAAATGCAG ACAGTCGTGG TAATTGTCCC AAGAAACTGT TTATGGGCCA TTATTTCCTC
CGATTTGTTG CTGCCAGTCG TGTGTGTCAG ATCCATGTAG CATCGTGTCT CGTAGCCCCA ACATCAACAT ATGATCATTG
CCCGTCGATA ATGAGATAAC ATATGCTTGC CGTG

Locus: Os01g0819500

Loading...

Locus: Os01g0819500

Loading...