Os01t0820700-00

Locus

Os01g0820700

Description

DNA-binding WRKY domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY116

CGSNL Gene Name

WRKY GENE 116

Oryzabase Gene Symbol Synonym(s)

OsWRKY116

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

Q5QMC1 (UniProt)

Literature

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

DNA-binding WRKY (IPR003657)

Expression Databases

TENOR (Os01t0820700-00)

Others

Oryzabase (9207)

Transcript

852 bp

>Os01t0820700-00 DNA-binding WRKY domain containing protein.
ATGGCGTCGCCGCGGCTGAAGAGGGAGCAGTCGTTCGACTTCGAGGAGGCGAGCGCGCAG
GAAGCCGTGGGATCCGCGTCGGCGTCGTACAGCCCTCCCGGGGGCGGCGGCGTCTTTGGC
ATCTCGCCGCCGGAGTCCTCGCCGCGCGACGGCCGGAAGAGAAGGAAGGATAGACCATCA
TTGGTGAAACATACGTTCACACCTCATTTTGATGGTCATTTGTGGAGGAAGTATGGCCAG
AAGAACATCAAGGACTCTGCTTTCCCTAGGTTATATTACAGATGCTCTTACCGTGAGGAC
AGACAGtgccttgcctccaagctggtgcagcaggagaacgacgacgacccgccactgtac
agggtcacctacacgtacgagcacacctgcaacaccaCGCCCGTCCCGACCCCCGACGTC
GTGGCCGAGCAGCCGCCGCCGGGCGCCGCCGGCGACGCGTACCTCCTCAGGTTCGGCTCC
TCCGCTGGCGGCGGCGGCGGCGGCGCTCATCAGCAGCAGACCGAGCGAGAACGACAGCAG
CAAAATACAGCGAGAAGAAGGCCATTCATGATGCTGAGCTTCGATTCTAGTAGCAGCCAT
CAGCTGCACGAGCAGCCGCACGCGTTCCCTCCCGACGGCCAGCTGCCGGCCACGGCCGCG
GCCGCGTCGCCGTCGTCGTTCACGGCAGCCGAGGCGTTGGCGGCGCCGCCGCTCACGACG
ACGATGAACGACGGAGGCGACCTGTTCTCGACGTGGGACGCGCTCAGGTATGGTTTGGAC
TATGACCACGGGCACCTTGGTAACCATGTTTATCTCCCTGATGACTGTAATGGTGGTGAT
GATAATTACTGA

CDS

852 bp

>Os01t0820700-00 DNA-binding WRKY domain containing protein.
ATGGCGTCGCCGCGGCTGAAGAGGGAGCAGTCGTTCGACTTCGAGGAGGCGAGCGCGCAG
GAAGCCGTGGGATCCGCGTCGGCGTCGTACAGCCCTCCCGGGGGCGGCGGCGTCTTTGGC
ATCTCGCCGCCGGAGTCCTCGCCGCGCGACGGCCGGAAGAGAAGGAAGGATAGACCATCA
TTGGTGAAACATACGTTCACACCTCATTTTGATGGTCATTTGTGGAGGAAGTATGGCCAG
AAGAACATCAAGGACTCTGCTTTCCCTAGGTTATATTACAGATGCTCTTACCGTGAGGAC
AGACAGtgccttgcctccaagctggtgcagcaggagaacgacgacgacccgccactgtac
agggtcacctacacgtacgagcacacctgcaacaccaCGCCCGTCCCGACCCCCGACGTC
GTGGCCGAGCAGCCGCCGCCGGGCGCCGCCGGCGACGCGTACCTCCTCAGGTTCGGCTCC
TCCGCTGGCGGCGGCGGCGGCGGCGCTCATCAGCAGCAGACCGAGCGAGAACGACAGCAG
CAAAATACAGCGAGAAGAAGGCCATTCATGATGCTGAGCTTCGATTCTAGTAGCAGCCAT
CAGCTGCACGAGCAGCCGCACGCGTTCCCTCCCGACGGCCAGCTGCCGGCCACGGCCGCG
GCCGCGTCGCCGTCGTCGTTCACGGCAGCCGAGGCGTTGGCGGCGCCGCCGCTCACGACG
ACGATGAACGACGGAGGCGACCTGTTCTCGACGTGGGACGCGCTCAGGTATGGTTTGGAC
TATGACCACGGGCACCTTGGTAACCATGTTTATCTCCCTGATGACTGTAATGGTGGTGAT
GATAATTACTGA

Protein

284 aa

>Os01t0820700-00 DNA-binding WRKY domain containing protein.
MASPRLKREQSFDFEEASAQEAVGSASASYSPPGGGGVFGISPPESSPRDGRKRRKDRPS
LVKHTFTPHFDGHLWRKYGQKNIKDSAFPRLYYRCSYREDRQCLASKLVQQENDDDPPLY
RVTYTYEHTCNTTPVPTPDVVAEQPPPGAAGDAYLLRFGSSAGGGGGGAHQQQTERERQQ
QNTARRRPFMMLSFDSSSSHQLHEQPHAFPPDGQLPATAAAASPSSFTAAEALAAPPLTT
TMNDGGDLFSTWDALRYGLDYDHGHLGNHVYLPDDCNGGDDNY*

CDS

chr01:34996792..34996955 (+ strand) : 164 bp

chr01:35001792..35001896 (+ strand) : 105 bp

chr01:35002644..35003226 (+ strand) : 583 bp

FASTA

>Os01t0820700-00 class=Sequence position=chr01:34996792..35003226 (+ strand)
ATGGCGTCGC CGCGGCTGAA GAGGGAGCAG TCGTTCGACT TCGAGGAGGC GAGCGCGCAG GAAGCCGTGG GATCCGCGTC
GGCGTCGTAC AGCCCTCCCG GGGGCGGCGG CGTCTTTGGC ATCTCGCCGC CGGAGTCCTC GCCGCGCGAC GGCCGGAAGA
GAAGGTACTA TACTACACGA GCTAGCTAAG CTAGCACACA CAGATGTTAA TTTGTTAATT AGTACCTGTA TCTCCTTGAT
TGCTTCGTGT TTAATTTCGT CGATTCGTTC ATATATTTTG CCTCTCTCCA ACCACTTCTT GTTTACCTCT CTTGCTGTCT
TGAATGGATT AATTTCTGGA GCCGCTGATC CTAACTGCGC TTTGCTGATT TGAGTTGTGT GTACCTGTTT GCCCTTTCTT
TTTCTTCGTT TCTTGAGTCT GCCAAAATTA AGGAGAATGG GAATTATAGT TTCTGGCTTC TGTGTGGTAT GCCAATATGG
GGAAATTTTT GGGGAAATTA AGGAGGAGGA AGAAACATTA ACATGGTCAT AAACAGGCAA TGTTAGGATC TATATGTGGG
GTTGGTAGAT AGTATGTACT ATATTGCAAC TTGAATTTAA TGGTTTAATT ACTACTAAAA AGAATGACGA AACCTTGTAC
GATTGAGGGT GATAACGCTA GCTCGTCTGC ACTATTAAAA CAAACAGATT GAAAAATTAA ACCAATTAAA TGGATGCATA
CTACCCCAAC TATCAAGGTT TTTCTTTCCT CCATCGATCT TAATTTCTTC CTTTGAGTTG TCCTACTTTT GAGTGAGCTA
GCTATATTTC ATGAGCTGAG GTGAAAGCGG AAAATTAATA CGCTTTTTTT TTTTGGGGGG GGGGCATAAT GTTTTGCTCA
AGTTTGGATT GAGATTCTGC ACTACAGTAA AAGGACATGC CATTAATAAA TTAAAATCAT CAAACATCAC ATATATGCTA
ATAGCCATTT TCAGCATTCT TCATAATTCA CCAAGAAGAT GCATATTCTC CTCCTTTGAA TGAAGACCAT TTCTTTTTGA
CACTTAGGAA CCCGAAGTGA TCATATGTTG TTCCATTTTC TTAACATATG TCCATGCATC TTTGCCATAG TGGAGGGCTC
CATTAATTGC TTGAGAACCC TACCTTACTA CTAGTTCTAG ATTGGAGCTC TTCCTGCACA TTTTAAGCAT GCTAGCTTAT
AACAAGAAAA CAAAGAATGC ACATAGAGAA GTCTCGAATC TTCTTTGTTA TATATATATA TCGAATTACC AACTGATCGA
ACCAACCTTT GTTTCTTTCC TTAGCAGTAA TAGTCCACAA TTAGTAGTAT TTTATGACTC ACAAGCATAT ACTTTTCTTC
TAAAAGAGGT AAAAATTAAA GGAAACAAGA AAGTAACAAG CACATGCATG TCGGCAGTCC ATCTTCATCA CTTCATGCAT
GCAGCATCCA TAAAGTTCCA CTAACCATTT CTCCTTCCTA GTTAAGTTTA AGATATATCC ATGAACTTAT TCATACTTGT
GATTCTCATT CTCATACACT CCCATCCCCC TAACTATACA GTGTTATCCT GATCAACTTG TGTAGTATTG TGTGTTAGTG
TTTTGACTTA TTCTTACTAT TGACCTATGT ATCCTTGATA CAGTTTTTCT TCTGTTGTCC TCAAGCCTCA ACCTCAATTA
ATGCAATGGC AAATTGAAAC TCCTTAGTTC TAAACAAAAT GTTTTGATCC TTCATTTATA TATATATTCC TATGCTGGTA
AACTTCTTTC TTTTTTGGAC ATGAACATTA TTAATCGGGA ATTAGGACCC TTCATAGTGT GAGTTGACTA CAAGTCTTCC
AGGGGGGAGT GTACACGGTC AGAGACCAAG CGCATACGTA TGAACTAGTG CGTAGACTTG ATCAAATTAA CTCATAGTAT
TAGATAAGGA CATATTGATC AGTTATGTGG AACACTAAGC CATTTATTAT TTACGGGAGA CGTTTAACTC TTTCTCTATC
CACTCAGATT AATCCTGTCT CGAACTACAC CTATTTGTAA GTGAACACTA GAGCTTATTC AATTCTGGCC ATTTTTCATT
TTAAGAATGA GAAAAGGGCA TTTCTGACGG CATTGCTTCA TTGATCATAA TATTTTTGCA TGTGACAATC TGAAGTGCGT
ACGTTGCACA CACATTATTT CACAAAGATT CATGAATAGT GTTTAGCCAC TATATATTCA CACCAACAAT TAAATTTTGA
TCTTGATATA TAGATTGAAA TCTAGATATT AGTACAGCAA GATATCAGTG ACATTTGTCA GAAGATCAGA GCATACACAC
ACACACACAC AGGAACCATA CTCTTATATT TTCAGATAAT TAATGAATAT ATCAACCCGG TCTCTACATC CTTCAAAGAA
GGATGTACAT CGGCAACAAA ATAAAAACGA GTTCTAGACT CTAGCCCTCA CACGAGGAAG CATTAAACAT AATTAACAAA
AGTTCAGATT CTCAAACACC AAACTTAACA CCAAGCTACA ATTCTTTTTT CTAAAATTCC ATCCGACGAA CCTGCAAACA
ACTCCATAGC TGCAATTCCA AGATCACTAC ATGGCTACAC CATGACCACC TTTCGCCAAC ACATGAATAT GTAGGGGAAA
AGCATGATTA CCTTCTAAGC AGTTCCTCAG CTCTCGGCCC CTCTCTTTTA ATTTCTAAGC AGTTGCAACC TATATTTTGC
CTAGTATATA TATGTTGCCT TGAAAATCAT ATGTAAGTAA GAAATAATGA ATTAATTAAT TTGCTTCCAT ATTAAGGATC
ACAAAATTTC TATTCAAACA ACAAACCGCC CAGCTTATTG TAGCAACTCC CACAAAAAAA ATGATGCTTG CAACATGCAA
TATCAAGATC AATGTGATGA ATTTGTTGAG ATTAAAATAA AGAAAGAAAG GGTGATATAT ATAGCCATGC CATTGCATAG
TAAAACCGAC CAAAAATTTC TAAAGGACAA CATCAAAAGA TTAGTCGCTA TTTTTCACAA GTTATACCCC ATTATTTGAA
CGTTTTGACA GTACACTTGA AACCGTTGCC TTTCATCCTT ATAAAAGAAT CGAGAGCGTC AGTAAAACTA CCATGCATAT
ATAAGTGTAT TTTCAGCTGA TCTAGCTAAT TAACCTATTG TCCAAACAAA TTCAAGTTCG AATATCAACT TAACTGTTGA
TAAAAAGGTT GGGAGAGCAT GTATTTCATT GTTCCTCGGT CGTGTCTAGG CTCCATTATT ATACAAGTCA TGAATTTGGC
TGAAATTATT CTATCTTAAA ATCATATAAA TTTGTGTACT GTTAGGAATG TTAAGAACAG TGTTAATTAG CACTGCTTTG
CGCCCCTTCT TATTAGATTA TTTTTGTGGT CCTGGCTCAT CCACTATTCT CAACATGTCA ATAAAAAGTG GGCACCACTA
ATATATATAC TCACATTCCA GCTAGTTTCC ATAGATCCAC AGTACTATGG ATCACATGAA AAGCTAGAGA AGCATTTCTG
AATCTGTCTG ATGAAAAAAG AATCTTTAAT TATTCTAGAT TCTTCATGTC TCATATGGCA TGCGTTCGGG GGAGGTGGTA
ACCCATTTAG AAGGGGTACG TATTTAATTT ACCAACTTAT CAACAGATTC AGATCCATTT CCCTTTAAAT AAGCTAATGA
CCCAGACATT GACATAAGCA TGCATGCAAA TAACGGAGAT CAAGCAACTA CTACTAGCTA GGCCCCCTTC AACATGCATG
TCTCGTGTAC ATGTCCTACT CTGATGGAGG CCATCCAACT CACCCATATG CATGCTTCTT TTTAACAATG GATAAAAAAT
CGGGGATATA CACAGTACTT AAAGGATAAA GAATACTTAA ATTTTAAATC TCATAACTAA GAAACAAGAG AAAAAAAAAC
TAAAAGACTA AGCTTCGAAC Ttactccatt cgtttcacaa cgtaagtcat tttagcattt ccaacattca tattaatgtt
aatgaatcta gacatatata tctatctaga ttcattaaca tcaatatgaa tacgggaaat gcattcatat taatgttaat
gaatctagac atatatatct atctaaattc attaacatca atatgaatgc gggaaatgct agaatgactt acattgtgaa
acggtggtag taCTACCGTT GCGTCATAAG ATTGCACTGA GTCGATTTTG ATATAGAGGC CATGCTAACA CGAAACAACT
AACACAGTAC TTCAATCTCG CTAAGTTCAG ATATAGTACG TGGTAAATAC ACCCTGGATA CTACATACAT ATATATACAT
ATATAGTACA CATAATTAAT TTGTTATATG TTGTACTTAT AATGCGACTT TGTTTGCAAG TAGTCATTAG TGTTGTACAA
CAACTAACTG ACAAGGTTAT GTTTTTCAAA TATATATAAG CGTGCATGTT GCAATATCTG GCCACATAAT TAATTAGGCC
AGCAATTATA TATGTAATGG TGCTTGTTTT TAACTTCATG TAAACATCGA TCGTTCATTA TTAATTTAGT CCTGTAGAAC
TATTTCTGTA CTCGAGGTAT CTTTTTCTTG TATATTATCA GTCATGTGCG ATTCTTTGCA TATTATTCAT GTATATTGGA
ACATTTTTTT CTATATTACC TCCTCCGATC ATAAATAttt gacacatttg acattaatca tttgtcttat ttaaaaaata
tatattatat tttattttct tgtgacttgt tttattatta aagttacttt aaacgtaaca tatattttta tatatttgta
ctaaaattct gaataagatg aatggttaaa TTTTATGGGC AAATCAATTG CATGAAATAA ATATTTATGA TCCGAGGAAG
TATATATTGT CACTTTTGAT GTATCCTAAT TAATATAGCA GGTTTTATTA TTTTCATAAC ATTGTAAAAT TACTTGCTAA
CTTTTTCTAT TTGAACTGTA TACACGGAGT ATTGCTGCAG GAAGGATAGA CCATCATTGG TGAAACATAC GTTCACACCT
CATTTTGATG GTCATTTGTG GAGGAAGTAT GGCCAGAAGA ACATCAAGGA CTCTGCTTTC CCTAGGTAAT TAAATTAGTC
ATTATCTAAA TAGAACCTAA ATTATTTATC TGTTGACTAT CAGCTGTAAA AAGTTTTAAG TCATGCATTC TGTTCATATT
GAGAAATGAC ATATTAAGAA ATGATATAAT ATGTGCTCTT GTTGGTTTCA ATCATCTAGG TTGTTCTTTT ATTGTTTACT
ATGAGAATAT ATTATAGAAA TAAATTGTTA TAATATTTTA GAATGTTTCA TTTGCTGTGA ATTACTATAA AAAAGTGAAG
AGTAAAATTG ACAGATGGGA ATATTAAGCT ACCAGGAGTC AAACAACAAA AACTCGAAAT TACTATCTAG CAAAGTTATG
GTTAATTTAG CACACACATT TTCAGATGAT AGTTTTCATA TGAAAGTTTT CTTGATGAAA GTTTCAAAAT AAAAGCTTTC
TGGATGAATG TTTTCCTGGT AGACGTTTTT CTAAAAGTTC TCATACAAAA GTTTTTGGGA AAAAAATATG TGTGTTGTGA
ATGTAGCAAT CCCATCTAAA AGTAGCTTTT AGTCAATTTA TTTCTTGCAT ATTGGGATTT CCATTGAAAT ATTATGCATG
GTCAGCAGTA GGCTACTTGG CTACAACAAA CTATTAACAA TAGTAACTGT ACTAGTACTT AAAAAAGTTC AGAGTTCAAA
ATCAACCTAA TTTGTGGTAA AACCGCGCGG CGAGATCCTA ATCTTAAGAT GCATTTAAAT CTTATGCATC TGTACTGTAA
ATGGAATCGC AGGTTATATT ACAGATGCTC TTACCGTGAG GACAGACAGt gccttgcctc caagctggtg cagcaggaga
acgacgacga cccgccactg tacagggtca cctacacgta cgagcacacc tgcaacacca CGCCCGTCCC GACCCCCGAC
GTCGTGGCCG AGCAGCCGCC GCCGGGCGCC GCCGGCGACG CGTACCTCCT CAGGTTCGGC TCCTCCGCTG GCGGCGGCGG
CGGCGGCGCT CATCAGCAGC AGACCGAGCG AGAACGACAG CAGCAAAATA CAGCGAGAAG AAGGCCATTC ATGATGCTGA
GCTTCGATTC TAGTAGCAGC CATCAGCTGC ACGAGCAGCC GCACGCGTTC CCTCCCGACG GCCAGCTGCC GGCCACGGCC
GCGGCCGCGT CGCCGTCGTC GTTCACGGCA GCCGAGGCGT TGGCGGCGCC GCCGCTCACG ACGACGATGA ACGACGGAGG
CGACCTGTTC TCGACGTGGG ACGCGCTCAG GTATGGTTTG GACTATGACC ACGGGCACCT TGGTAACCAT GTTTATCTCC
CTGATGACTG TAATGGTGGT GATGATAATT ACTGA

Locus: Os01g0820700

Loading...

Locus: Os01g0820700

Loading...