Os01t0821800-01

Locus

Os01g0821800

Description

Nucleic acid-binding, OB-fold-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARC

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsARC

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK119168 (DDBJ, Best hit)

Protein Evidence

B6T3D4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: tRNA binding (GO:0000049)

Functional domain (InterPro)

tRNA-binding domain (IPR002547)

Glutathione S-transferase, C-terminal-like (IPR010987)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

Full-length cDNA

001-036-F11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0821800-01)

RiceXPro (AK119168)

Others

Oryzabase (22419)

KEGG (Os01t0821800-01)

Transcript

1501 bp

>Os01t0821800-01 Nucleic acid-binding, OB-fold-like domain containing protein.
TCCCCCATCTCACCCCCAAGCTCGGCGCAACCTCTCTCGACGTGCTAATGGCGGCGGCGG
CGGCGGACTTCGCGGCGAGCAAGCGGGCCATGGCCTACGCGCTCTGCAAGCACCTCAGCC
TCGATCCGAATACAATATCCAGTACAAGTATTGAAGAGAGTGATATTGCCACCCTGTTCT
CACATATTGTGAAATCGAGTGAAGATGAGGTACTGAAATGGGTTGAATTTTCCAGCAATT
TTGTTGGAAAATGTGGAGAACAGCATGCATTGCTTGGTAATCTGAATCAAGACTTGTCCC
AGAAATCAGTTCTGTTGGGTAATGGTTTTAAACCATCAGTTGCTGATATTGTTGTGTTTG
CAACCATACAAGTTTTTGTGAGTCATCTTGGTGAAAACGAGTTGCAGAAATATCCACATG
TATTGCGGTGGATGGACTATATCCAGAACATCGTTGATTTTGGCACAACAGTACAAAAGG
TTAACTTGACCAAATCTGTCTTCGATCCACCTTCTCATCCAAAGAAGGCAGATAAAGGTG
ACACTGATCCAAGTTCAAAGAAAGTTGTTTCAGGACAGAAGAATGTGGGCAAATCGGATG
CAAATGTTGATTCCAAGAAAGCTGCACCAGAGAATAAAGCTCCTGAGAATAAGGCAAATC
CTACTCCAGCAAAAAATAACAAACCTTCTGGGGATAAAAAGAAAGCCCAGGAGAAATCTG
CAGGAAAACCAAATGAGGGAGTTGCGGATAAAGCTCCACAGAAAACTGCAGAAAAGGACT
CAGAATGCAATGTCAGTATCCTGAATATACAGGTTGGCCTTATTCGCAAAGCATGGAAGC
ACCCATCTGCTGACAGCCTCTTGGTTGAGGAGATAGATTTGGGAGATGGCAATGTGCATC
AAGTTGTTAGTGGGCTTGCCAAGTTCTTCAGCCCAGAGGAACTTGTTAATCGGCATGTTG
TATTAATCACGAATGTGAAGCCTGGGAAGCTGCGAGACGTAATGTCTGCCGGATTGGTCT
TGTGTGCTTCAAATCAAGATCATACAGTTGTAGAGCCATTGATTCCTCCAGAAGGAGCTA
AGCCTGGAGAGCGTATTTCATTTGCAGGGTTTGATGGGAAGCCAGAAGATGTTCTTAATC
CGAAGAAGAAACAGCTCGACAAGATCACACCGGATCTTCACACTGATGGAAATGGAATTG
CAACATACCGAGGGGTACCCTTCACTACATCTGCTGGTCCATGTAGATCTTCTGTTCCTA
ATGCGAGCATTAAGTGAGCAGTTATTTTAACAGATTCCAAACATTGTTGTGCTATAACAC
ATGCTAGGTGGATGTACTATTTCATCTTGCATCTTATTACATGCCCTATCAACTGTTGTC
AGCGTAGCGTCCATCTACTGTGATATCTAATAGAAAATTTTGACTAGCCAATGTGAAGAA
CATTTGTATTACCTTGCACCAAATGCAAAATCCTTCATGAACACGGTTGTTTTCAGGCAG
G

CDS

1230 bp

>Os01t0821800-01 Nucleic acid-binding, OB-fold-like domain containing protein.
ATGGCGGCGGCGGCGGCGGACTTCGCGGCGAGCAAGCGGGCCATGGCCTACGCGCTCTGC
AAGCACCTCAGCCTCGATCCGAATACAATATCCAGTACAAGTATTGAAGAGAGTGATATT
GCCACCCTGTTCTCACATATTGTGAAATCGAGTGAAGATGAGGTACTGAAATGGGTTGAA
TTTTCCAGCAATTTTGTTGGAAAATGTGGAGAACAGCATGCATTGCTTGGTAATCTGAAT
CAAGACTTGTCCCAGAAATCAGTTCTGTTGGGTAATGGTTTTAAACCATCAGTTGCTGAT
ATTGTTGTGTTTGCAACCATACAAGTTTTTGTGAGTCATCTTGGTGAAAACGAGTTGCAG
AAATATCCACATGTATTGCGGTGGATGGACTATATCCAGAACATCGTTGATTTTGGCACA
ACAGTACAAAAGGTTAACTTGACCAAATCTGTCTTCGATCCACCTTCTCATCCAAAGAAG
GCAGATAAAGGTGACACTGATCCAAGTTCAAAGAAAGTTGTTTCAGGACAGAAGAATGTG
GGCAAATCGGATGCAAATGTTGATTCCAAGAAAGCTGCACCAGAGAATAAAGCTCCTGAG
AATAAGGCAAATCCTACTCCAGCAAAAAATAACAAACCTTCTGGGGATAAAAAGAAAGCC
CAGGAGAAATCTGCAGGAAAACCAAATGAGGGAGTTGCGGATAAAGCTCCACAGAAAACT
GCAGAAAAGGACTCAGAATGCAATGTCAGTATCCTGAATATACAGGTTGGCCTTATTCGC
AAAGCATGGAAGCACCCATCTGCTGACAGCCTCTTGGTTGAGGAGATAGATTTGGGAGAT
GGCAATGTGCATCAAGTTGTTAGTGGGCTTGCCAAGTTCTTCAGCCCAGAGGAACTTGTT
AATCGGCATGTTGTATTAATCACGAATGTGAAGCCTGGGAAGCTGCGAGACGTAATGTCT
GCCGGATTGGTCTTGTGTGCTTCAAATCAAGATCATACAGTTGTAGAGCCATTGATTCCT
CCAGAAGGAGCTAAGCCTGGAGAGCGTATTTCATTTGCAGGGTTTGATGGGAAGCCAGAA
GATGTTCTTAATCCGAAGAAGAAACAGCTCGACAAGATCACACCGGATCTTCACACTGAT
GGAAATGGAATTGCAACATACCGAGGGGTACCCTTCACTACATCTGCTGGTCCATGTAGA
TCTTCTGTTCCTAATGCGAGCATTAAGTGA

Protein

410 aa

>Os01t0821800-01 Nucleic acid-binding, OB-fold-like domain containing protein.
MAAAAADFAASKRAMAYALCKHLSLDPNTISSTSIEESDIATLFSHIVKSSEDEVLKWVE
FSSNFVGKCGEQHALLGNLNQDLSQKSVLLGNGFKPSVADIVVFATIQVFVSHLGENELQ
KYPHVLRWMDYIQNIVDFGTTVQKVNLTKSVFDPPSHPKKADKGDTDPSSKKVVSGQKNV
GKSDANVDSKKAAPENKAPENKANPTPAKNNKPSGDKKKAQEKSAGKPNEGVADKAPQKT
AEKDSECNVSILNIQVGLIRKAWKHPSADSLLVEEIDLGDGNVHQVVSGLAKFFSPEELV
NRHVVLITNVKPGKLRDVMSAGLVLCASNQDHTVVEPLIPPEGAKPGERISFAGFDGKPE
DVLNPKKKQLDKITPDLHTDGNGIATYRGVPFTTSAGPCRSSVPNASIK*

5'UTR

chr01:35074442..35074488 (- strand) : 47 bp

CDS

chr01:35074361..35074441 (- strand) : 81 bp

chr01:35073322..35073402 (- strand) : 81 bp

chr01:35073076..35073246 (- strand) : 171 bp

chr01:35072913..35072978 (- strand) : 66 bp

chr01:35072324..35072392 (- strand) : 69 bp

chr01:35071805..35071921 (- strand) : 117 bp

chr01:35071250..35071473 (- strand) : 224 bp

chr01:35071063..35071153 (- strand) : 91 bp

chr01:35070878..35070946 (- strand) : 69 bp

chr01:35070388..35070479 (- strand) : 92 bp

chr01:35069906..35069969 (- strand) : 64 bp

chr01:35069507..35069611 (- strand) : 105 bp

3'UTR

chr01:35069283..35069506 (- strand) : 224 bp

FASTA

>Os01t0821800-01 class=Sequence position=chr01:35069283..35074488 (- strand)
TCCCCCATCT CACCCCCAAG CTCGGCGCAA CCTCTCTCGA CGTGCTAATG GCGGCGGCGG CGGCGGACTT CGCGGCGAGC
AAGCGGGCCA TGGCCTACGC GCTCTGCAAG CACCTCAGCC TCGATCCGGT GATTCCCCGA CTCTCTAGCC ATAAAACCGT
GGATTTCTGT TCTGGTCGCT TCGAAGCAAA AGCTTTCTCC TGCTATTGTT GTTGTTTAGT GCTGTCGTTG TGCAGGCTAA
AGGCCGATTT TCTTATATTT CCGTGTTGAG GTCTTGGTTG TTGAAGTTCT TCGGGGGGAT TAGTTCACTC GTAGTAGTAG
TATTTAGTAT TTGATAGACT CGTGAGGTGA ATCTCATAAT GCGATTGTAT TGTGCTGTCG GATTTAGGGT ATGGTTACTT
CAAGCGTATA GTACGTAGTT GGGGAGTCGA AAGATATGCA GTTATCTGCT GTACAATTGT TCGATTTGTG GCAGGCCGTG
AATTGATGGG AGCAGTAGTG GATTTTTTGC ATCATATACT ATATCCACTA TGCAAACCAT GAGTCCAGGA TTGAACAGGA
TCGTCCTTGC TGTTGATTAG CTTCGTGCTT CTCTAGTTCT CTTAATTACT CTAAGCAGTG CAATTAGATG ATTAATCTAG
TTAGCTTCCA ATGTTTTTGG CTGCTGCCTG CCACATAGTA CTATGTCACA GTCTATACCT TGTAAATTGT AACAGTTACT
CTAATACTCC AATAGAATCA ATGTGCAAAC GCTTTTACCA AATGCAACAT ATGCCCTTGT AGTCAGCTCT TAATTAAGTA
GCTTGCTACC TTAGTTCACA TAGTGCCTAC TCTATTTCTT TAACTGGTGC CTGGTCATGG ACTTGATACT CCTGAAATCT
GACTTGAATA TTTGACTGGT GTACAAGGCA CAACGTTTGT TGTATTGCTA CACTGTTGGC CCACTTATAT GCACTTCACA
GTTCACCGTT CATTACTAGT TCATTTGGAC AAACTTTGCC TGGCTCACTC TTATAAATCT CCAATTGCAC AATTGAGTTC
TACCTGGGCT GGAAGCTTCT ACTAATTTCT GCGCTGAATA TTACAGAATA CAATATCCAG TACAAGTATT GAAGAGAGTG
ATATTGCCAC CCTGTTCTCA CATATTGTGA AATCGAGTGA AGATGAGGTA ACTGTTTTTC CACGCATGTA CACTAATAAC
ACGTAGTACT ACTTATATAT TGACAGATTT CTTCACTGAT AGGTACTGAA ATGGGTTGAA TTTTCCAGCA ATTTTGTTGG
AAAATGTGGA GAACAGCATG CATTGCTTGG TAATCTGAAT CAAGACTTGT CCCAGAAATC AGTTCTGTTG GGTAATGGTT
TTAAACCATC AGTTGCTGAT ATTGTTGTGT TTGCAACCAT ACAAGTTTTT GTGGTAAGTA TGATGTGATT ACTCATTTGT
ATGACCACCA TCAATGGTCA TTCATAAAAG CAGAAGTTCT GAGATTTTAA CCTTTTACTG CTTGTTTCAG AGTCATCTTG
GTGAAAACGA GTTGCAGAAA TATCCACATG TATTGCGGTG GATGGACTAT ATCCAGGTTC GAAATAAAAC TTTATTTATT
TTGTACTATC ATACTTTGTT AGTATCTTTT TTCAtactac ctccgtgcca taatataagc acatctagca tttgaaattt
gttccaaaat ataagcacgt ctagagtact aattcactca ccaaccaCCC TAATTTATGA GGGGCATCAT AGTCTTTTCT
GCTTAACCTT AGTCTTTGCT AGAAAACCTA GATTTGCTTA TATTTTGGAA TGGAAGTAGT AGTTTGTTGC TATATGTTGT
CAACATGAAG TACATGTGCC CTTCATTCTG GATAAAATAA CCAAACGCAT ATAGTTTTTT TACCGTTTCT CTTGACAGTC
CCCTATGTTG CTTTCTGTGG TATACCAGCA CTGAGGTGAA TGCACATACC ATGTTTTTTT TCCTTGTTTG TTGCCTGGTC
TTATTACCAG TTTGTTCATA CTTTATACCT TAATAATCAG ACCCATATTA CCATTTTATT TTTACATCTT ATGTGAGTAC
TTACTGATTG ACGCAGAACA TCGTTGATTT TGGCACAACA GTACAAAAGG TTAACTTGAC CAAATCTGTC TTCGATCCAC
CTTCTGTAAG TAAAGATCCT TTCCCAATGT GGGCTAGAAG TATTACATTT TGGGGGTACA CATATTCTTG AATTCCTTTG
TTGTATACTT TCAGATGTTA TAAGAGACAG AGTTGAAGAA AATTAACTCT GTCAACTTAA TGCAACCTAC TGTGTTTAAA
TACAATTTTG TGCTTGGTCT GAAAATACCT GTACATGTTC ATATCAGTTT ATGTTTAGGA TCTGGTTGAT ATAAAACCTT
TGTAAGAACT ACTGACATAA TCTGTGGAAG TGCCATAGTG CTGGGAAGAA ATATAAATAT CAACAATTTT TGTAAAATAA
TCATACAGTA TTTCCTGTTC AGTATGCTAT TTGAATAAAC AAATTTGTTG AGGAGTAATT GTACAATTTC CTATTTCTGT
GTGACAGCAT CCAAAGAAGG CAGATAAAGG TGACACTGAT CCAAGTTCAA AGAAAGTTGT TTCAGGACAG AAGAATGTGG
GCAAATCGGA TGCAAATGTT GATTCCAAGA AAGCTGCACC AGAGGTAGTT CATTATGCAA TTATGCCAAT TATCACTAGT
ACTTTGCAGT TCTGGATTAG TATGATATTA TCTCAGAGAG GTATTGGTAA TTCATGTTAC TTTGAAGATT TGGCTGGAAT
TGATATTATT GCATTTTCAA CTCTTCTCTA GCTGCAATTC ATGTAGGGTC TCATGTGCAA ATGCAGAACA AAACTCTGTG
GACTTTATGT CCAATAAAGC TCTTTAATCA GCACATAAAG TATTAAAATG CTTTATGATG TACAGATATC TGTTGTGGAA
GCTATTTTTT TCCCCTTTCA AGTTAGTTGA TTAGTTCCTT TGTTGGTTGA ATCAGAATAA AGCTCCTGAG AATAAGGCAA
ATCCTACTCC AGCAAAAAAT AACAAACCTT CTGGGGATAA AAAGAAAGCC CAGGAGAAAT CTGCAGGAAA ACCAAATGAG
GGAGTTGCGG ATAAAGCTCC ACAGAAAACT GCAGAAAAGG ACTCAGAATG CAATGTCAGT ATCCTGAATA TACAGGTTGG
CCTTATTCGC AAAGCATGGA AGCACCCATC TGCTGACAGG TACCCATAAC TTTTCTGCTT ATGCAACAAT TCAAAATGGT
TCAACAGTTG TATTGTGCTC TTTGAACAAA TATTCTAACT GGTCTCTCTT TTCAGCCTCT TGGTTGAGGA GATAGATTTG
GGAGATGGCA ATGTGCATCA AGTTGTTAGT GGGCTTGCCA AGTTCTTCAG CCCAGAGGAA CTTGTTGTGA GTATTTAACA
GCAACAATGG ACTTGAATTA TTCCTGTTCA TTTTTCTTGC CATGAAATTG TTTCATCCAA GATTCTGTTT TCTGTAATAA
ACAACTGCCT TTTCCTTCAC AGAATCGGCA TGTTGTATTA ATCACGAATG TGAAGCCTGG GAAGCTGCGA GACGTAATGT
CTGCCGGATT GGTATGTTCT ATTCCATAAA TTATATTTAT GCTCGTGTAC AGGCAAAGCA TCTTGATATG TGTCAAGCAG
TTGATTTATA AACTACATCC AACATGTGAC AAAAGATCCA TGAGCCTATG ATGGAATACT AGCTTTAAAT AGGCATTGCT
GTAGACCCCA AATCATTAGG TCATGTGTAT GCTCTTGAAG TCTACTGTAG TACATCTAAA ATAGGCAATG TAACACTTCT
CACTGATGAA ACAATGAACT ATTTTAGAAG TGAAGCCTCA CCATGTGCTT GGTATCACTT ATTTAGTCAT TTGTGTTCTT
TCTCCAGTCT TAGAAATGGT AGGAATATAA ACTTTAAGTT AGGAAGTCCT AATTTCCAAA TGTTGTTTTC ACATTGAACA
TATTGCCAGG TCTTGTGTGC TTCAAATCAA GATCATACAG TTGTAGAGCC ATTGATTCCT CCAGAAGGAG CTAAGCCTGG
AGAGCGTATT TCATTTGCAG GGTAAGAATT ATGTTGTATA GATGTGATAT CTGCATTAAA ATTTTAAAAA ACGTGTTTGT
GCAGTTCTGG GGAGCATGTT CTGTTCAATT TGACCTATTT GCATTCATGG CTTTAAAGTC AGCTTGCACA AGCTTATATG
CAATTACTGT CTTTTAGATT GTTATACAAG TTGTCCCCTA ATATGTTGGT CGTAAGGGAA GTCCAAACAG GATGGACCCA
TGTTGTGTGA TGATCTTTCT GTCGTCTTTC AAGGAAAATA ATATTTTAGC GTAGTTAGCA TTTCGGTTGT TATTAGTAGT
GTCTTGTGCT GTAGAAATTA TTTGATTGTG TTTGGTGTCC TGCACCGTTT GTGAAGAAAA AAAATGTTTA TAACTGTCCA
CCTTTCAGTT CAGTTAAATT ACTTATCCTT CACATATAGG TTTGATGGGA AGCCAGAAGA TGTTCTTAAT CCGAAGAAGA
AACAGCTCGA CAAGATCACA CCGGTATGCT TTTACCAATG CGCTATTTTT GCATGATGCT CTAAGTTATT TTTCCCTTTT
AGCAATCACA TGATTAGTCT GCCCTTCCAG CACAATCTGG GTGAATTAAA TCAGTTGTCA TTTCTTTTGC ACATCTGGGT
GTCATTTTTT ACATTGCCTT AACAAATTCA ATAATTAAAT ACAGACAATT CACAAATCGT GTTTGCTATG CGCTGAGTGC
TCTTGAAGGC TGTTGTGTAT CCATTTGTAT ATATACTGCA TGAATCAACC AATAATTAAA TTTTATCATG CACCCAGGAT
CTTCACACTG ATGGAAATGG AATTGCAACA TACCGAGGGG TACCCTTCAC TACATCTGCT GGTCCATGTA GATCTTCTGT
TCCTAATGCG AGCATTAAGT GAGCAGTTAT TTTAACAGAT TCCAAACATT GTTGTGCTAT AACACATGCT AGGTGGATGT
ACTATTTCAT CTTGCATCTT ATTACATGCC CTATCAACTG TTGTCAGCGT AGCGTCCATC TACTGTGATA TCTAATAGAA
AATTTTGACT AGCCAATGTG AAGAACATTT GTATTACCTT GCACCAAATG CAAAATCCTT CATGAACACG GTTGTTTTCA
GGCAGG

Locus: Os01g0821800

Loading...

Locus: Os01g0821800

Loading...