Os01t0821800-02

Locus

Os01g0821800

Description

Similar to methionyl-tRNA synthetase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARC

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsARC

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK073951 (DDBJ, Best hit)

Protein Evidence

B6T3D4 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Glutathione S-transferase, C-terminal-like (IPR010987)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

Full-length cDNA

J033075A05 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0821800-02)

RiceXPro (AK073951)

Others

Oryzabase (22419)

KEGG (Os01t0821800-02)

Transcript

625 bp

>Os01t0821800-02 Similar to methionyl-tRNA synthetase.
TCTCACCCCCAAGCTCGGCGCAACCTCTCTCGACGTGCTAATGGCGGCGGCGGCGGCGGA
CTTCGCGGCGAGCAAGCGGGCCATGGCCTACGCGCTCTGCAAGCACCTCAGCCTCGATCC
GAATACAATATCCAGTACAAGTATTGAAGAGAGTGATATTGCCACCCTGTTCTCACATAT
TGTGAAATCGAGTGAAGATGAGGTACTGAAATGGGTTGAATTTTCCAGCAATTTTGTTGG
AAAATGTGGAGAACAGCATGCATTGCTTGGTAATCTGAATCAAGACTTGTCCCAGAAATC
AGTTCTGTTGGGTAATGGTTTTAAACCATCAGTTGCTGATATTGTTGTGTTTGCAACCAT
ACAAGTTTTTGTGAGTCATCTTGGTGAAAACGAGTTGCAGAAATATCCACATGTATTGCG
GTGGATGGACTATATCCAGAACATCGTTGATTTTGGCACAACAGTACAAAAGGTTAACTT
GACCAAATCTGTCTTCGATCCACCTTCTCATCCAAAGAAGGCAGATAAAGGTGACACTGA
TCCAAGTTCAAAGAAAGTTGTTTCAGGACAGAAGAATGTGGGCAAATCGGATGCAAATGT
TGATTCCAAGAAAGCTGCACCAGAG

CDS

585 bp

>Os01t0821800-02 Similar to methionyl-tRNA synthetase.
ATGGCGGCGGCGGCGGCGGACTTCGCGGCGAGCAAGCGGGCCATGGCCTACGCGCTCTGC
AAGCACCTCAGCCTCGATCCGAATACAATATCCAGTACAAGTATTGAAGAGAGTGATATT
GCCACCCTGTTCTCACATATTGTGAAATCGAGTGAAGATGAGGTACTGAAATGGGTTGAA
TTTTCCAGCAATTTTGTTGGAAAATGTGGAGAACAGCATGCATTGCTTGGTAATCTGAAT
CAAGACTTGTCCCAGAAATCAGTTCTGTTGGGTAATGGTTTTAAACCATCAGTTGCTGAT
ATTGTTGTGTTTGCAACCATACAAGTTTTTGTGAGTCATCTTGGTGAAAACGAGTTGCAG
AAATATCCACATGTATTGCGGTGGATGGACTATATCCAGAACATCGTTGATTTTGGCACA
ACAGTACAAAAGGTTAACTTGACCAAATCTGTCTTCGATCCACCTTCTCATCCAAAGAAG
GCAGATAAAGGTGACACTGATCCAAGTTCAAAGAAAGTTGTTTCAGGACAGAAGAATGTG
GGCAAATCGGATGCAAATGTTGATTCCAAGAAAGCTGCACCAGAG

Protein

195 aa

>Os01t0821800-02 Similar to methionyl-tRNA synthetase.
MAAAAADFAASKRAMAYALCKHLSLDPNTISSTSIEESDIATLFSHIVKSSEDEVLKWVE
FSSNFVGKCGEQHALLGNLNQDLSQKSVLLGNGFKPSVADIVVFATIQVFVSHLGENELQ
KYPHVLRWMDYIQNIVDFGTTVQKVNLTKSVFDPPSHPKKADKGDTDPSSKKVVSGQKNV
GKSDANVDSKKAAPE

5'UTR

chr01:35074442..35074481 (- strand) : 40 bp

CDS

chr01:35074361..35074441 (- strand) : 81 bp

chr01:35073322..35073402 (- strand) : 81 bp

chr01:35073076..35073246 (- strand) : 171 bp

chr01:35072913..35072978 (- strand) : 66 bp

chr01:35072324..35072392 (- strand) : 69 bp

chr01:35071805..35071921 (- strand) : 117 bp

FASTA

>Os01t0821800-02 class=Sequence position=chr01:35071805..35074481 (- strand)
TCTCACCCCC AAGCTCGGCG CAACCTCTCT CGACGTGCTA ATGGCGGCGG CGGCGGCGGA CTTCGCGGCG AGCAAGCGGG
CCATGGCCTA CGCGCTCTGC AAGCACCTCA GCCTCGATCC GGTGATTCCC CGACTCTCTA GCCATAAAAC CGTGGATTTC
TGTTCTGGTC GCTTCGAAGC AAAAGCTTTC TCCTGCTATT GTTGTTGTTT AGTGCTGTCG TTGTGCAGGC TAAAGGCCGA
TTTTCTTATA TTTCCGTGTT GAGGTCTTGG TTGTTGAAGT TCTTCGGGGG GATTAGTTCA CTCGTAGTAG TAGTATTTAG
TATTTGATAG ACTCGTGAGG TGAATCTCAT AATGCGATTG TATTGTGCTG TCGGATTTAG GGTATGGTTA CTTCAAGCGT
ATAGTACGTA GTTGGGGAGT CGAAAGATAT GCAGTTATCT GCTGTACAAT TGTTCGATTT GTGGCAGGCC GTGAATTGAT
GGGAGCAGTA GTGGATTTTT TGCATCATAT ACTATATCCA CTATGCAAAC CATGAGTCCA GGATTGAACA GGATCGTCCT
TGCTGTTGAT TAGCTTCGTG CTTCTCTAGT TCTCTTAATT ACTCTAAGCA GTGCAATTAG ATGATTAATC TAGTTAGCTT
CCAATGTTTT TGGCTGCTGC CTGCCACATA GTACTATGTC ACAGTCTATA CCTTGTAAAT TGTAACAGTT ACTCTAATAC
TCCAATAGAA TCAATGTGCA AACGCTTTTA CCAAATGCAA CATATGCCCT TGTAGTCAGC TCTTAATTAA GTAGCTTGCT
ACCTTAGTTC ACATAGTGCC TACTCTATTT CTTTAACTGG TGCCTGGTCA TGGACTTGAT ACTCCTGAAA TCTGACTTGA
ATATTTGACT GGTGTACAAG GCACAACGTT TGTTGTATTG CTACACTGTT GGCCCACTTA TATGCACTTC ACAGTTCACC
GTTCATTACT AGTTCATTTG GACAAACTTT GCCTGGCTCA CTCTTATAAA TCTCCAATTG CACAATTGAG TTCTACCTGG
GCTGGAAGCT TCTACTAATT TCTGCGCTGA ATATTACAGA ATACAATATC CAGTACAAGT ATTGAAGAGA GTGATATTGC
CACCCTGTTC TCACATATTG TGAAATCGAG TGAAGATGAG GTAACTGTTT TTCCACGCAT GTACACTAAT AACACGTAGT
ACTACTTATA TATTGACAGA TTTCTTCACT GATAGGTACT GAAATGGGTT GAATTTTCCA GCAATTTTGT TGGAAAATGT
GGAGAACAGC ATGCATTGCT TGGTAATCTG AATCAAGACT TGTCCCAGAA ATCAGTTCTG TTGGGTAATG GTTTTAAACC
ATCAGTTGCT GATATTGTTG TGTTTGCAAC CATACAAGTT TTTGTGGTAA GTATGATGTG ATTACTCATT TGTATGACCA
CCATCAATGG TCATTCATAA AAGCAGAAGT TCTGAGATTT TAACCTTTTA CTGCTTGTTT CAGAGTCATC TTGGTGAAAA
CGAGTTGCAG AAATATCCAC ATGTATTGCG GTGGATGGAC TATATCCAGG TTCGAAATAA AACTTTATTT ATTTTGTACT
ATCATACTTT GTTAGTATCT TTTTTCAtac tacctccgtg ccataatata agcacatcta gcatttgaaa tttgttccaa
aatataagca cgtctagagt actaattcac tcaccaacca CCCTAATTTA TGAGGGGCAT CATAGTCTTT TCTGCTTAAC
CTTAGTCTTT GCTAGAAAAC CTAGATTTGC TTATATTTTG GAATGGAAGT AGTAGTTTGT TGCTATATGT TGTCAACATG
AAGTACATGT GCCCTTCATT CTGGATAAAA TAACCAAACG CATATAGTTT TTTTACCGTT TCTCTTGACA GTCCCCTATG
TTGCTTTCTG TGGTATACCA GCACTGAGGT GAATGCACAT ACCATGTTTT TTTTCCTTGT TTGTTGCCTG GTCTTATTAC
CAGTTTGTTC ATACTTTATA CCTTAATAAT CAGACCCATA TTACCATTTT ATTTTTACAT CTTATGTGAG TACTTACTGA
TTGACGCAGA ACATCGTTGA TTTTGGCACA ACAGTACAAA AGGTTAACTT GACCAAATCT GTCTTCGATC CACCTTCTGT
AAGTAAAGAT CCTTTCCCAA TGTGGGCTAG AAGTATTACA TTTTGGGGGT ACACATATTC TTGAATTCCT TTGTTGTATA
CTTTCAGATG TTATAAGAGA CAGAGTTGAA GAAAATTAAC TCTGTCAACT TAATGCAACC TACTGTGTTT AAATACAATT
TTGTGCTTGG TCTGAAAATA CCTGTACATG TTCATATCAG TTTATGTTTA GGATCTGGTT GATATAAAAC CTTTGTAAGA
ACTACTGACA TAATCTGTGG AAGTGCCATA GTGCTGGGAA GAAATATAAA TATCAACAAT TTTTGTAAAA TAATCATACA
GTATTTCCTG TTCAGTATGC TATTTGAATA AACAAATTTG TTGAGGAGTA ATTGTACAAT TTCCTATTTC TGTGTGACAG
CATCCAAAGA AGGCAGATAA AGGTGACACT GATCCAAGTT CAAAGAAAGT TGTTTCAGGA CAGAAGAATG TGGGCAAATC
GGATGCAAAT GTTGATTCCA AGAAAGCTGC ACCAGAG

Locus: Os01g0821800

Loading...

Locus: Os01g0821800

Loading...