Os01t0821800-03

Locus

Os01g0821800

Description

Nucleic acid-binding, OB-fold-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARC

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsARC

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK103171 (DDBJ, Best hit)

Protein Evidence

B6T3D4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: tRNA binding (GO:0000049)

Functional domain (InterPro)

tRNA-binding domain (IPR002547)

Glutathione S-transferase, C-terminal-like (IPR010987)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

Full-length cDNA

J033121G11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0821800-03)

Others

Oryzabase (22419)

Transcript

1492 bp

>Os01t0821800-03 Nucleic acid-binding, OB-fold-like domain containing protein.
GGCGCAACCTCTCTCGACGTGCTAATGGCGGCGGCGGCGGCGGACTTCGCGGCGAGCAAG
CGGGCCATGGCCTACGCGCTCTGCAAGCACCTCAGCCTCGATCCGAATACAATATCCAGT
ACAAGTATTGAAGAGAGTGATATTGCCACCCTGTTCTCACATATTGTGAAATCGAGTGAA
GATGAGGTACTGAAATGGGTTGAATTTTCCAGCAATTTTGTTGGAAAATGTGGAGAACAG
CATGCATTGCTTGGTAATCTGAATCAAGACTTGTCCCAGAAATCAGTTCTGTTGGGTAAT
GGTTTTAAACCATCAGTTGCTGATATTGTTGTGTTTGCAACCATACAAGTTTTTGTGAGT
CATCTTGGTGAAAACGAGTTGCAGAAATATCCACATGTATTGCGGTGGATGGACTATATC
CAGAACATCGTTGATTTTGGCACAACAGTACAAAAGGTTAACTTGACCAAATCTGTCTTC
GATCCACCTTCTCATCCAAAGAAGGCAGATAAAGGTGACACTGATCCAAGTTCAAAGAAA
GTTGTTTCAGGACAGAAGAATGTGGGCAAATCGGATGCAAATGTTGATTCCAAGAAAGCT
GCACCAGAGAATAAAGCTCCTGAGAATAAGGCAAATCCTACTCCAGCAAAAAATAACAAA
CCTTCTGGGGATAAAAAGAAAGCCCAGGAGAAATCTGCAGGAAAACCAAATGAGGGAGTT
GCGGATAAAGCTCCACAGAAAACTGCAGAAAAGGACTCAGAATGCAATGTCAGTATCCTG
AATATACAGGTTGGCCTTATTCGCAAAGCATGGAAGCACCCATCTGCTGACAGCCTCTTG
GTTGAGGAGATAGATTTGGGAGATGGCAATGTGCATCAAGTTGTTAGTGGGCTTGCCAAG
TTCTTCAGCCCAGAGGAACTTGTTAATCGGCATGTTGTATTAATCACGAATGTGAAGCCT
GGGAAGCTGCGAGACGTAATGTCTGCCGGATTGGTCTTGTGTGCTTCAAATCAAGATCAT
ACAGTTGTAGAGCCATTGATTCCTCCAGAAGGAGCTAAGCCTGGAGAGCGTATTTCATTT
GCAGGGTTTGATGGGAAGCCAGAAGATGTTCTTAATCCGAAGAAGAAACAGCTCGACAAG
ATCACACCGGATCTTCACACTGATGGAAATGGAATTGCAACATACCGAGGGGTACCCTTC
ACTACATCTGCTGGTCCATGTAGATCTTCTGTTCCTAATGCGAGCATTAAGTGAGCAGTT
ATTTTAACAGATTCCAAACATTGTTGTGCTATAACACATGCTAGGTGGATGTACTATTTC
ATCTTGCATCTTATTACATGCCCTATCAACTGTTGTCAGCGTAGCGTCCATCTACTGTGA
TATCTAATAGAAAATTTTGACTAGCCAATGTGAAGAACATTTGTATTACCTTGCACCAAA
TGCAAAATCCTTCATGAACACGGTTGTTTTCAGGCAGGATTTCTGATGAGTC

CDS

1230 bp

>Os01t0821800-03 Nucleic acid-binding, OB-fold-like domain containing protein.
ATGGCGGCGGCGGCGGCGGACTTCGCGGCGAGCAAGCGGGCCATGGCCTACGCGCTCTGC
AAGCACCTCAGCCTCGATCCGAATACAATATCCAGTACAAGTATTGAAGAGAGTGATATT
GCCACCCTGTTCTCACATATTGTGAAATCGAGTGAAGATGAGGTACTGAAATGGGTTGAA
TTTTCCAGCAATTTTGTTGGAAAATGTGGAGAACAGCATGCATTGCTTGGTAATCTGAAT
CAAGACTTGTCCCAGAAATCAGTTCTGTTGGGTAATGGTTTTAAACCATCAGTTGCTGAT
ATTGTTGTGTTTGCAACCATACAAGTTTTTGTGAGTCATCTTGGTGAAAACGAGTTGCAG
AAATATCCACATGTATTGCGGTGGATGGACTATATCCAGAACATCGTTGATTTTGGCACA
ACAGTACAAAAGGTTAACTTGACCAAATCTGTCTTCGATCCACCTTCTCATCCAAAGAAG
GCAGATAAAGGTGACACTGATCCAAGTTCAAAGAAAGTTGTTTCAGGACAGAAGAATGTG
GGCAAATCGGATGCAAATGTTGATTCCAAGAAAGCTGCACCAGAGAATAAAGCTCCTGAG
AATAAGGCAAATCCTACTCCAGCAAAAAATAACAAACCTTCTGGGGATAAAAAGAAAGCC
CAGGAGAAATCTGCAGGAAAACCAAATGAGGGAGTTGCGGATAAAGCTCCACAGAAAACT
GCAGAAAAGGACTCAGAATGCAATGTCAGTATCCTGAATATACAGGTTGGCCTTATTCGC
AAAGCATGGAAGCACCCATCTGCTGACAGCCTCTTGGTTGAGGAGATAGATTTGGGAGAT
GGCAATGTGCATCAAGTTGTTAGTGGGCTTGCCAAGTTCTTCAGCCCAGAGGAACTTGTT
AATCGGCATGTTGTATTAATCACGAATGTGAAGCCTGGGAAGCTGCGAGACGTAATGTCT
GCCGGATTGGTCTTGTGTGCTTCAAATCAAGATCATACAGTTGTAGAGCCATTGATTCCT
CCAGAAGGAGCTAAGCCTGGAGAGCGTATTTCATTTGCAGGGTTTGATGGGAAGCCAGAA
GATGTTCTTAATCCGAAGAAGAAACAGCTCGACAAGATCACACCGGATCTTCACACTGAT
GGAAATGGAATTGCAACATACCGAGGGGTACCCTTCACTACATCTGCTGGTCCATGTAGA
TCTTCTGTTCCTAATGCGAGCATTAAGTGA

Protein

410 aa

>Os01t0821800-03 Nucleic acid-binding, OB-fold-like domain containing protein.
MAAAAADFAASKRAMAYALCKHLSLDPNTISSTSIEESDIATLFSHIVKSSEDEVLKWVE
FSSNFVGKCGEQHALLGNLNQDLSQKSVLLGNGFKPSVADIVVFATIQVFVSHLGENELQ
KYPHVLRWMDYIQNIVDFGTTVQKVNLTKSVFDPPSHPKKADKGDTDPSSKKVVSGQKNV
GKSDANVDSKKAAPENKAPENKANPTPAKNNKPSGDKKKAQEKSAGKPNEGVADKAPQKT
AEKDSECNVSILNIQVGLIRKAWKHPSADSLLVEEIDLGDGNVHQVVSGLAKFFSPEELV
NRHVVLITNVKPGKLRDVMSAGLVLCASNQDHTVVEPLIPPEGAKPGERISFAGFDGKPE
DVLNPKKKQLDKITPDLHTDGNGIATYRGVPFTTSAGPCRSSVPNASIK*

5'UTR

chr01:35074442..35074465 (- strand) : 24 bp

CDS

chr01:35074361..35074441 (- strand) : 81 bp

chr01:35073322..35073402 (- strand) : 81 bp

chr01:35073076..35073246 (- strand) : 171 bp

chr01:35072913..35072978 (- strand) : 66 bp

chr01:35072324..35072392 (- strand) : 69 bp

chr01:35071805..35071921 (- strand) : 117 bp

chr01:35071250..35071473 (- strand) : 224 bp

chr01:35071063..35071153 (- strand) : 91 bp

chr01:35070878..35070946 (- strand) : 69 bp

chr01:35070388..35070479 (- strand) : 92 bp

chr01:35069906..35069969 (- strand) : 64 bp

chr01:35069507..35069611 (- strand) : 105 bp

3'UTR

chr01:35069269..35069506 (- strand) : 238 bp

FASTA

>Os01t0821800-03 class=Sequence position=chr01:35069269..35074465 (- strand)
GGCGCAACCT CTCTCGACGT GCTAATGGCG GCGGCGGCGG CGGACTTCGC GGCGAGCAAG CGGGCCATGG CCTACGCGCT
CTGCAAGCAC CTCAGCCTCG ATCCGGTGAT TCCCCGACTC TCTAGCCATA AAACCGTGGA TTTCTGTTCT GGTCGCTTCG
AAGCAAAAGC TTTCTCCTGC TATTGTTGTT GTTTAGTGCT GTCGTTGTGC AGGCTAAAGG CCGATTTTCT TATATTTCCG
TGTTGAGGTC TTGGTTGTTG AAGTTCTTCG GGGGGATTAG TTCACTCGTA GTAGTAGTAT TTAGTATTTG ATAGACTCGT
GAGGTGAATC TCATAATGCG ATTGTATTGT GCTGTCGGAT TTAGGGTATG GTTACTTCAA GCGTATAGTA CGTAGTTGGG
GAGTCGAAAG ATATGCAGTT ATCTGCTGTA CAATTGTTCG ATTTGTGGCA GGCCGTGAAT TGATGGGAGC AGTAGTGGAT
TTTTTGCATC ATATACTATA TCCACTATGC AAACCATGAG TCCAGGATTG AACAGGATCG TCCTTGCTGT TGATTAGCTT
CGTGCTTCTC TAGTTCTCTT AATTACTCTA AGCAGTGCAA TTAGATGATT AATCTAGTTA GCTTCCAATG TTTTTGGCTG
CTGCCTGCCA CATAGTACTA TGTCACAGTC TATACCTTGT AAATTGTAAC AGTTACTCTA ATACTCCAAT AGAATCAATG
TGCAAACGCT TTTACCAAAT GCAACATATG CCCTTGTAGT CAGCTCTTAA TTAAGTAGCT TGCTACCTTA GTTCACATAG
TGCCTACTCT ATTTCTTTAA CTGGTGCCTG GTCATGGACT TGATACTCCT GAAATCTGAC TTGAATATTT GACTGGTGTA
CAAGGCACAA CGTTTGTTGT ATTGCTACAC TGTTGGCCCA CTTATATGCA CTTCACAGTT CACCGTTCAT TACTAGTTCA
TTTGGACAAA CTTTGCCTGG CTCACTCTTA TAAATCTCCA ATTGCACAAT TGAGTTCTAC CTGGGCTGGA AGCTTCTACT
AATTTCTGCG CTGAATATTA CAGAATACAA TATCCAGTAC AAGTATTGAA GAGAGTGATA TTGCCACCCT GTTCTCACAT
ATTGTGAAAT CGAGTGAAGA TGAGGTAACT GTTTTTCCAC GCATGTACAC TAATAACACG TAGTACTACT TATATATTGA
CAGATTTCTT CACTGATAGG TACTGAAATG GGTTGAATTT TCCAGCAATT TTGTTGGAAA ATGTGGAGAA CAGCATGCAT
TGCTTGGTAA TCTGAATCAA GACTTGTCCC AGAAATCAGT TCTGTTGGGT AATGGTTTTA AACCATCAGT TGCTGATATT
GTTGTGTTTG CAACCATACA AGTTTTTGTG GTAAGTATGA TGTGATTACT CATTTGTATG ACCACCATCA ATGGTCATTC
ATAAAAGCAG AAGTTCTGAG ATTTTAACCT TTTACTGCTT GTTTCAGAGT CATCTTGGTG AAAACGAGTT GCAGAAATAT
CCACATGTAT TGCGGTGGAT GGACTATATC CAGGTTCGAA ATAAAACTTT ATTTATTTTG TACTATCATA CTTTGTTAGT
ATCTTTTTTC Atactacctc cgtgccataa tataagcaca tctagcattt gaaatttgtt ccaaaatata agcacgtcta
gagtactaat tcactcacca accaCCCTAA TTTATGAGGG GCATCATAGT CTTTTCTGCT TAACCTTAGT CTTTGCTAGA
AAACCTAGAT TTGCTTATAT TTTGGAATGG AAGTAGTAGT TTGTTGCTAT ATGTTGTCAA CATGAAGTAC ATGTGCCCTT
CATTCTGGAT AAAATAACCA AACGCATATA GTTTTTTTAC CGTTTCTCTT GACAGTCCCC TATGTTGCTT TCTGTGGTAT
ACCAGCACTG AGGTGAATGC ACATACCATG TTTTTTTTCC TTGTTTGTTG CCTGGTCTTA TTACCAGTTT GTTCATACTT
TATACCTTAA TAATCAGACC CATATTACCA TTTTATTTTT ACATCTTATG TGAGTACTTA CTGATTGACG CAGAACATCG
TTGATTTTGG CACAACAGTA CAAAAGGTTA ACTTGACCAA ATCTGTCTTC GATCCACCTT CTGTAAGTAA AGATCCTTTC
CCAATGTGGG CTAGAAGTAT TACATTTTGG GGGTACACAT ATTCTTGAAT TCCTTTGTTG TATACTTTCA GATGTTATAA
GAGACAGAGT TGAAGAAAAT TAACTCTGTC AACTTAATGC AACCTACTGT GTTTAAATAC AATTTTGTGC TTGGTCTGAA
AATACCTGTA CATGTTCATA TCAGTTTATG TTTAGGATCT GGTTGATATA AAACCTTTGT AAGAACTACT GACATAATCT
GTGGAAGTGC CATAGTGCTG GGAAGAAATA TAAATATCAA CAATTTTTGT AAAATAATCA TACAGTATTT CCTGTTCAGT
ATGCTATTTG AATAAACAAA TTTGTTGAGG AGTAATTGTA CAATTTCCTA TTTCTGTGTG ACAGCATCCA AAGAAGGCAG
ATAAAGGTGA CACTGATCCA AGTTCAAAGA AAGTTGTTTC AGGACAGAAG AATGTGGGCA AATCGGATGC AAATGTTGAT
TCCAAGAAAG CTGCACCAGA GGTAGTTCAT TATGCAATTA TGCCAATTAT CACTAGTACT TTGCAGTTCT GGATTAGTAT
GATATTATCT CAGAGAGGTA TTGGTAATTC ATGTTACTTT GAAGATTTGG CTGGAATTGA TATTATTGCA TTTTCAACTC
TTCTCTAGCT GCAATTCATG TAGGGTCTCA TGTGCAAATG CAGAACAAAA CTCTGTGGAC TTTATGTCCA ATAAAGCTCT
TTAATCAGCA CATAAAGTAT TAAAATGCTT TATGATGTAC AGATATCTGT TGTGGAAGCT ATTTTTTTCC CCTTTCAAGT
TAGTTGATTA GTTCCTTTGT TGGTTGAATC AGAATAAAGC TCCTGAGAAT AAGGCAAATC CTACTCCAGC AAAAAATAAC
AAACCTTCTG GGGATAAAAA GAAAGCCCAG GAGAAATCTG CAGGAAAACC AAATGAGGGA GTTGCGGATA AAGCTCCACA
GAAAACTGCA GAAAAGGACT CAGAATGCAA TGTCAGTATC CTGAATATAC AGGTTGGCCT TATTCGCAAA GCATGGAAGC
ACCCATCTGC TGACAGGTAC CCATAACTTT TCTGCTTATG CAACAATTCA AAATGGTTCA ACAGTTGTAT TGTGCTCTTT
GAACAAATAT TCTAACTGGT CTCTCTTTTC AGCCTCTTGG TTGAGGAGAT AGATTTGGGA GATGGCAATG TGCATCAAGT
TGTTAGTGGG CTTGCCAAGT TCTTCAGCCC AGAGGAACTT GTTGTGAGTA TTTAACAGCA ACAATGGACT TGAATTATTC
CTGTTCATTT TTCTTGCCAT GAAATTGTTT CATCCAAGAT TCTGTTTTCT GTAATAAACA ACTGCCTTTT CCTTCACAGA
ATCGGCATGT TGTATTAATC ACGAATGTGA AGCCTGGGAA GCTGCGAGAC GTAATGTCTG CCGGATTGGT ATGTTCTATT
CCATAAATTA TATTTATGCT CGTGTACAGG CAAAGCATCT TGATATGTGT CAAGCAGTTG ATTTATAAAC TACATCCAAC
ATGTGACAAA AGATCCATGA GCCTATGATG GAATACTAGC TTTAAATAGG CATTGCTGTA GACCCCAAAT CATTAGGTCA
TGTGTATGCT CTTGAAGTCT ACTGTAGTAC ATCTAAAATA GGCAATGTAA CACTTCTCAC TGATGAAACA ATGAACTATT
TTAGAAGTGA AGCCTCACCA TGTGCTTGGT ATCACTTATT TAGTCATTTG TGTTCTTTCT CCAGTCTTAG AAATGGTAGG
AATATAAACT TTAAGTTAGG AAGTCCTAAT TTCCAAATGT TGTTTTCACA TTGAACATAT TGCCAGGTCT TGTGTGCTTC
AAATCAAGAT CATACAGTTG TAGAGCCATT GATTCCTCCA GAAGGAGCTA AGCCTGGAGA GCGTATTTCA TTTGCAGGGT
AAGAATTATG TTGTATAGAT GTGATATCTG CATTAAAATT TTAAAAAACG TGTTTGTGCA GTTCTGGGGA GCATGTTCTG
TTCAATTTGA CCTATTTGCA TTCATGGCTT TAAAGTCAGC TTGCACAAGC TTATATGCAA TTACTGTCTT TTAGATTGTT
ATACAAGTTG TCCCCTAATA TGTTGGTCGT AAGGGAAGTC CAAACAGGAT GGACCCATGT TGTGTGATGA TCTTTCTGTC
GTCTTTCAAG GAAAATAATA TTTTAGCGTA GTTAGCATTT CGGTTGTTAT TAGTAGTGTC TTGTGCTGTA GAAATTATTT
GATTGTGTTT GGTGTCCTGC ACCGTTTGTG AAGAAAAAAA ATGTTTATAA CTGTCCACCT TTCAGTTCAG TTAAATTACT
TATCCTTCAC ATATAGGTTT GATGGGAAGC CAGAAGATGT TCTTAATCCG AAGAAGAAAC AGCTCGACAA GATCACACCG
GTATGCTTTT ACCAATGCGC TATTTTTGCA TGATGCTCTA AGTTATTTTT CCCTTTTAGC AATCACATGA TTAGTCTGCC
CTTCCAGCAC AATCTGGGTG AATTAAATCA GTTGTCATTT CTTTTGCACA TCTGGGTGTC ATTTTTTACA TTGCCTTAAC
AAATTCAATA ATTAAATACA GACAATTCAC AAATCGTGTT TGCTATGCGC TGAGTGCTCT TGAAGGCTGT TGTGTATCCA
TTTGTATATA TACTGCATGA ATCAACCAAT AATTAAATTT TATCATGCAC CCAGGATCTT CACACTGATG GAAATGGAAT
TGCAACATAC CGAGGGGTAC CCTTCACTAC ATCTGCTGGT CCATGTAGAT CTTCTGTTCC TAATGCGAGC ATTAAGTGAG
CAGTTATTTT AACAGATTCC AAACATTGTT GTGCTATAAC ACATGCTAGG TGGATGTACT ATTTCATCTT GCATCTTATT
ACATGCCCTA TCAACTGTTG TCAGCGTAGC GTCCATCTAC TGTGATATCT AATAGAAAAT TTTGACTAGC CAATGTGAAG
AACATTTGTA TTACCTTGCA CCAAATGCAA AATCCTTCAT GAACACGGTT GTTTTCAGGC AGGATTTCTG ATGAGTC

Locus: Os01g0821800

Loading...

Locus: Os01g0821800

Loading...