Os01t0822900-03

Locus

Os01g0822900

Description

Non-specific lipid transfer protein (nsLTP), Regulation of plant height

RAP-DB Gene Symbol Synonym(s)

PTD1, Psd1

RAP-DB Gene Name Synonym(s)

Photoperiod-thermo-sensitive dwarfism 1, Photoperiod-sensitive dwarf 1

CGSNL Gene Symbol

PTD1

CGSNL Gene Name

PHOTOPERIOD-THERMO-SENSITIVE DWARFISM 1

Oryzabase Gene Symbol Synonym(s)

OsLTP1.2, OsLtpI.2, OsPTD1, Psd1

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.2, lipid transfer protein 1.2, type 1 non-specific lipid transfer protein 2, Photoperiod-thermo-sensitive dwarfism 1, Photoperiod-sensitive dwarf 1

Transcript Evidence

AK120044

AK071598

AK104079

AK119174

AK119258

AK119732

Protein Evidence

Q5QM60

Literature

PMID: 31701134

PMID: 24158250

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

July 9, 2020

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain superfamily (IPR036312)

Plant lipid transfer protein/Par allergen (IPR000528)

Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain (IPR016140)

Full-length cDNA

002-188-F08 (Online Clone Ordering)

J023107C11 (Online Clone Ordering)

001-028-G08 (Online Clone Ordering)

001-037-F03 (Online Clone Ordering)

001-125-H04 (Online Clone Ordering)

002-158-A02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0822900-03)

Others

Oryzabase (13511)

Transcript

815 bp

>Os01t0822900-03 Non-specific lipid transfer protein (nsLTP), Regulation of plant height
ACACGTTTCAGCTGTCTTTCAGTGTTCACGTAGGTTGTAGAGAGCACAACAACGTACGTA
CACAGCAGCAAAGACTGAGACTAGCTAGCTTAGCTGACATGGCTCCAAGGTGCGCGACGC
TGGCGGTGGTGGTGGTGCTGGTGGCGGCCGTGGTGGCGCCGCCGACGGCGGTGCGCGCGG
CTATCTCGTGCTCGGCGGTGTACAACACGCTGATGCCGTGCCTGCCGTACGTGCAGGCGG
GGGGCACGGTGCCCAGGGCGTGCTGCGGCGGCATTCAGAGCCTGCTCGCCGCCGCCAACA
ACACCCCCGATCGCCGCACCATCTGCGGCTGCCTCAAGAACGTCGCCAACGGCGCCTCCG
GGGGCCCCTACATCACCCGCGCCGCCGCGCTCCCCTCCAAGTGCAACGTCTCCCTCCCTT
ACAAGATCAGCACCAGCGTCAACTGCAACGCGATAAACTAGGGCGGCCGGCCTGATGCGT
ACGTGTGTGCCCGCGCCTCCCGTACGAGAGGAGAATAAAATGTCATTAGTACCATCAAAT
TAAGCTAGCTAGTTAAGCTTTACGAAAATCGATCCCTTTCTTCCTCTGTGGTGTTTAGCA
GTTTAGGGATCGTATGTCTCCACAGTTCCTACTATAGTGTCGCTTGGGCGATGGTGGAGC
TATATTGTGCACTTTATAAGGTGGTGTTATTATGTAACGCCTGTGCTAGCTTTGGTCCTG
ATGTTCTCCATGTGAACTGTGTCAACCGTCCATTGTTCTGCAAATCTGCAGTATGTACTG
TGTGTGATAGTATCAAGCTGAACTTCTGAACATGC

CDS

363 bp

>Os01t0822900-03 Non-specific lipid transfer protein (nsLTP), Regulation of plant height
ATGGCTCCAAGGTGCGCGACGCTGGCGGTGGTGGTGGTGCTGGTGGCGGCCGTGGTGGCG
CCGCCGACGGCGGTGCGCGCGGCTATCTCGTGCTCGGCGGTGTACAACACGCTGATGCCG
TGCCTGCCGTACGTGCAGGCGGGGGGCACGGTGCCCAGGGCGTGCTGCGGCGGCATTCAG
AGCCTGCTCGCCGCCGCCAACAACACCCCCGATCGCCGCACCATCTGCGGCTGCCTCAAG
AACGTCGCCAACGGCGCCTCCGGGGGCCCCTACATCACCCGCGCCGCCGCGCTCCCCTCC
AAGTGCAACGTCTCCCTCCCTTACAAGATCAGCACCAGCGTCAACTGCAACGCGATAAAC
TAG

Protein

121 aa

>Os01t0822900-03 Non-specific lipid transfer protein (nsLTP), Regulation of plant height
MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPYVQAGGTVPRACCGGIQ
SLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKCNVSLPYKISTSVNCNAIN
*

5'UTR

chr01:35130816..35130913 (- strand) : 98 bp

CDS

chr01:35130463..35130815 (- strand) : 353 bp

chr01:35130367..35130376 (- strand) : 10 bp

3'UTR

chr01:35130013..35130366 (- strand) : 354 bp

FASTA

>Os01t0822900-03 class=Sequence position=chr01:35130013..35130913 (- strand)
ACACGTTTCA GCTGTCTTTC AGTGTTCACG TAGGTTGTAG AGAGCACAAC AACGTACGTA CACAGCAGCA AAGACTGAGA
CTAGCTAGCT TAGCTGACAT GGCTCCAAGG TGCGCGACGC TGGCGGTGGT GGTGGTGCTG GTGGCGGCCG TGGTGGCGCC
GCCGACGGCG GTGCGCGCGG CTATCTCGTG CTCGGCGGTG TACAACACGC TGATGCCGTG CCTGCCGTAC GTGCAGGCGG
GGGGCACGGT GCCCAGGGCG TGCTGCGGCG GCATTCAGAG CCTGCTCGCC GCCGCCAACA ACACCCCCGA TCGCCGCACC
ATCTGCGGCT GCCTCAAGAA CGTCGCCAAC GGCGCCTCCG GGGGCCCCTA CATCACCCGC GCCGCCGCGC TCCCCTCCAA
GTGCAACGTC TCCCTCCCTT ACAAGATCAG CACCAGCGTC AACTGCAACG CGTACGTGCA CGCATAAACA CTCTCATACT
CTCATTAAAC GAAGTAGAAA ATTTTTACAG ACAAATTTAA TTTCTTTCTT TGTGCAGGAT AAACTAGGGC GGCCGGCCTG
ATGCGTACGT GTGTGCCCGC GCCTCCCGTA CGAGAGGAGA ATAAAATGTC ATTAGTACCA TCAAATTAAG CTAGCTAGTT
AAGCTTTACG AAAATCGATC CCTTTCTTCC TCTGTGGTGT TTAGCAGTTT AGGGATCGTA TGTCTCCACA GTTCCTACTA
TAGTGTCGCT TGGGCGATGG TGGAGCTATA TTGTGCACTT TATAAGGTGG TGTTATTATG TAACGCCTGT GCTAGCTTTG
GTCCTGATGT TCTCCATGTG AACTGTGTCA ACCGTCCATT GTTCTGCAAA TCTGCAGTAT GTACTGTGTG TGATAGTATC
AAGCTGAACT TCTGAACATG C

Locus: Os01g0822900

Loading...

Locus: Os01g0822900

Loading...