Os01t0824500-00

Locus

Os01g0824500

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

BT061171 (DDBJ)

Protein Evidence

NP_850143.1 (RefSeq)

Literature

Note

Manual Curation

Expression Databases

TENOR (Os01t0824500-00)

Others

KEGG (Os01t0824500-00)

Transcript

1037 bp

>Os01t0824500-00 Hypothetical conserved gene.
TTCTCGCTGATGTATTAAACCCGATCGATCGATGCATGCAGTGGTGGCCTTTGCCTGGAT
TCGGAGAGAGATCTGACGCCGCTACAGTGGCCAGTGGGAGGGCTACAAGACAGCTGTGAA
GCCGAACCGTCCCTTCGCGTCGCGGCACCGGCCGGCTTCGACTGACCCTGCCTTCCAGCT
TCCTAAATCTGGCCGGCTGATCAGCCTCCGCTCTACAGCTGCTGCCGCGGCGTGCGGCTT
GAAAAGGAGCTGGTTTTTGGGGGAGGCGCCAATGGCGAGCTCGGGGGGGAGGTGGAGGCG
GAGCGGCAGTTCCATGCTAAAGCTGGTGGTGGCCTTGTGCTTCTTCGCTGTGGCCATCTC
CCTGTGTTGCGTCTGCCTCAGCTCGGGTTGCGGTGGCAGTGGCTGTGGTGGATTCAGGCG
GCGCGCTGTGCTGCTCCGTTTAGGTAATGAAATTCAGCGAGCTGCATCCTTCTGCGCACT
TGATCACAGCTCGAGCGGGCGTCGATGGCGGCGGCTGCTGGCGGAGGGCCCGGGGTCGTA
CCCGCCGCGGTGCACGGCCAAGTGCGGCGCCTGCGTCCCGTGCTACCCGGTGCACGTCGC
CGTGCCGCCCGGCGTCCCGGTCACCACCGAGTACTACCCGGAGGCGTGGCGGTGCAAGTG
CGGCAACCGGCTCTACATGCCATGACGGGCAGAGCGTGCACGGCGGGGTGACGCTCCGGT
GGCGAAGCGATTTGCGCGAGGGTGGCGCGCGGTGGCCGGTGGGCGTGCCGGGCCGAGGTA
CTAGCACAGTACAGCAGTGCACTGCTGCCCGATCGAAGCGGCCGTCGCGCATGGGGCCGT
TTCATTATTGCGATGCGGGCCGGGAGCACAGTGGCAGTGTGGACTGTTGCCGCGCCCGCG
CGCGAATCGGGTGGAGGCGCGCGTGATGATGGCCTACTGGGCTGCTGGGCTCTGGAATTT
GCGCGGCCCTACCACGAGGAGCGGTGGCATGGGGTTGTACGGCGCGTGCTGCAAAGGGAA
GCGAGAAGGGGAGCACG

CDS

414 bp

>Os01t0824500-00 Hypothetical conserved gene.
ATGGCGAGCTCGGGGGGGAGGTGGAGGCGGAGCGGCAGTTCCATGCTAAAGCTGGTGGTG
GCCTTGTGCTTCTTCGCTGTGGCCATCTCCCTGTGTTGCGTCTGCCTCAGCTCGGGTTGC
GGTGGCAGTGGCTGTGGTGGATTCAGGCGGCGCGCTGTGCTGCTCCGTTTAGGTAATGAA
ATTCAGCGAGCTGCATCCTTCTGCGCACTTGATCACAGCTCGAGCGGGCGTCGATGGCGG
CGGCTGCTGGCGGAGGGCCCGGGGTCGTACCCGCCGCGGTGCACGGCCAAGTGCGGCGCC
TGCGTCCCGTGCTACCCGGTGCACGTCGCCGTGCCGCCCGGCGTCCCGGTCACCACCGAG
TACTACCCGGAGGCGTGGCGGTGCAAGTGCGGCAACCGGCTCTACATGCCATGA

Protein

138 aa

>Os01t0824500-00 Hypothetical conserved gene.
MASSGGRWRRSGSSMLKLVVALCFFAVAISLCCVCLSSGCGGSGCGGFRRRAVLLRLGNE
IQRAASFCALDHSSSGRRWRRLLAEGPGSYPPRCTAKCGACVPCYPVHVAVPPGVPVTTE
YYPEAWRCKCGNRLYMP*

5'UTR

chr01:35224585..35224855 (+ strand) : 271 bp

CDS

chr01:35224856..35225065 (+ strand) : 210 bp

chr01:35225864..35226067 (+ strand) : 204 bp

3'UTR

chr01:35226068..35226419 (+ strand) : 352 bp

FASTA

>Os01t0824500-00 class=Sequence position=chr01:35224585..35226419 (+ strand)
TTCTCGCTGA TGTATTAAAC CCGATCGATC GATGCATGCA GTGGTGGCCT TTGCCTGGAT TCGGAGAGAG ATCTGACGCC
GCTACAGTGG CCAGTGGGAG GGCTACAAGA CAGCTGTGAA GCCGAACCGT CCCTTCGCGT CGCGGCACCG GCCGGCTTCG
ACTGACCCTG CCTTCCAGCT TCCTAAATCT GGCCGGCTGA TCAGCCTCCG CTCTACAGCT GCTGCCGCGG CGTGCGGCTT
GAAAAGGAGC TGGTTTTTGG GGGAGGCGCC AATGGCGAGC TCGGGGGGGA GGTGGAGGCG GAGCGGCAGT TCCATGCTAA
AGCTGGTGGT GGCCTTGTGC TTCTTCGCTG TGGCCATCTC CCTGTGTTGC GTCTGCCTCA GCTCGGGTTG CGGTGGCAGT
GGCTGTGGTG GATTCAGGCG GCGCGCTGTG CTGCTCCGTT TAGGTAATGA AATTCAGCGA GCTGCATCCT TCTGCGCACT
TGTTTACTCC ATTTTGGTAT TCTCCAGTTC ACTGGCTAAT TCTGGCCACA ACCTGCTTGT TGGGTGTTTC ATTTCGTTTG
GTTCTGTATG TTTGTCGTCG TGGTTCATAT GTTCACTGCT CATGCTGATG CGAGTTCTTC GTTTCTGAAA TTCAATCTGG
ATAAGTTCAT TGCAGGCTTT AAGTTGAAAA TACTGCTATA ATGTTTTTGT TTCACTGTAT TACTCCTATA TCGGTACCAT
ATAGTATATC GGTTGAAATG TTCAAATCAC TCTGTAATAA TCCGTGTTAT CGTGTTTTCT GCAGATTTCC GGACACGAGC
AACAGCATAT TTTGGCGCTA ATCAGGTGAG TTTTGCATCT CCTCCCCCTT GCTATCCACT CTACATGCCC GCTACCATAA
GTTCGCATCG ATCAATGCAG TTCAACTTCA AACTGCAAAA TGATGAAACG ACGCGATTTA TTGTTGTTTA TCTGGCCCTC
AATCATCTTT CATCAGTTGT TGATTCGCGA TCGATGACAA GTCGAAATCA ACACAGAACA CTAGGCAACC TCACAGGGTC
CGCAATGGCA GTCCCCATTA GCGCGCACAG TCACGGCCAT GAAAGCTGGC GTCCTTCTCC GACAGCCGTT CAACGCCGGC
GGTCCCATCG CCTTTTGACC ATACGTCTCT GCCGATCGAT GCGTAGTAGT ACATCCAAAC GTAGCACGCC GGCACGCCGC
GCGTCACAGC GATACGTGAA AACGGTGAAA GGTTGAAGGA CGGTGATACG TAAATCCATT GTGTTTTGTG TTGTAGCAGG
ATCACAGCTC GAGCGGGCGT CGATGGCGGC GGCTGCTGGC GGAGGGCCCG GGGTCGTACC CGCCGCGGTG CACGGCCAAG
TGCGGCGCCT GCGTCCCGTG CTACCCGGTG CACGTCGCCG TGCCGCCCGG CGTCCCGGTC ACCACCGAGT ACTACCCGGA
GGCGTGGCGG TGCAAGTGCG GCAACCGGCT CTACATGCCA TGACGGGCAG AGCGTGCACG GCGGGGTGAC GCTCCGGTGG
CGAAGCGATT TGCGCGAGGG TGGCGCGCGG TGGCCGGTGG GCGTGCCGGG CCGAGGTACT AGCACAGTAC AGCAGTGCAC
TGCTGCCCGA TCGAAGCGGC CGTCGCGCAT GGGGCCGTTT CATTATTGCG ATGCGGGCCG GGAGCACAGT GGCAGTGTGG
ACTGTTGCCG CGCCCGCGCG CGAATCGGGT GGAGGCGCGC GTGATGATGG CCTACTGGGC TGCTGGGCTC TGGAATTTGC
GCGGCCCTAC CACGAGGAGC GGTGGCATGG GGTTGTACGG CGCGTGCTGC AAAGGGAAGC GAGAAGGGGA GCACG