Os01t0828900-00

Locus

Os01g0828900

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

G1L7

CGSNL Gene Name

G1 LIKE PROTEIN 7

Oryzabase Gene Symbol Synonym(s)

OsG1L7

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AB512496 (DDBJ, Best hit)

Protein Evidence

NP_563780.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF640 (IPR006936)

Expression Databases

TENOR (Os01t0828900-00)

Others

Oryzabase (8888)

KEGG (Os01t0828900-00)

Transcript

639 bp

>Os01t0828900-00 Similar to predicted protein.
ATGGATCCGTCTGGCCCCGGTCCGTCCTCTGCGGCGGCTGGCGGCGCGCCGGCCGTGGCG
GCGGCGCCGCAGCCGCCGGCGCAGCTGAGCAGGTACGAGTCGCAGAAGCGGAGGGACTGG
AACACGTTCCTGCAGTACCTGCGGAACCACCGGCCGCCGCTGACGCTGGCGCGGTGCAGC
GGCGCGCACGTGATCGAGTTCCTGAGGTACCTGGACCAGTTCGGGAAGACCAAGGTGCAC
GCGTCGGGGTGCGCCTTCTACGGCCAGCCCAGCCCGCCGGGGCCGTGCCCGTGCCCGCTG
CGTCAGGCGTGGGGATCCCTCGACGCGCTCATCGGCCGCCTCCGCGCCGCGTACGAGGAG
AGCGGCGGCACGCCCGAGTCCAACCCGTTCGCCGCGCGCGCCGTCCGGATCTACCTCCGC
GAGGTGCGGGACTCGCAGGCCAAGGCGCGCGGCATCCCGTACGAGAAGAAGAAGCGCAAG
CGCTCGCAGGCGGCGCAGCCCGCCGGCGTCGAGCCGTCCGGCTCGTCTTCTGCTGCAGCT
GCAGCTGCCGGTGGTGGAGACGCGGGCAGCGGTGGCGGTGCAGCTGCTACTACCACAGCT
CAACCTGGAGGGAGTGGCACTGCACCAAGCGCCTCCTGA

CDS

639 bp

>Os01t0828900-00 Similar to predicted protein.
ATGGATCCGTCTGGCCCCGGTCCGTCCTCTGCGGCGGCTGGCGGCGCGCCGGCCGTGGCG
GCGGCGCCGCAGCCGCCGGCGCAGCTGAGCAGGTACGAGTCGCAGAAGCGGAGGGACTGG
AACACGTTCCTGCAGTACCTGCGGAACCACCGGCCGCCGCTGACGCTGGCGCGGTGCAGC
GGCGCGCACGTGATCGAGTTCCTGAGGTACCTGGACCAGTTCGGGAAGACCAAGGTGCAC
GCGTCGGGGTGCGCCTTCTACGGCCAGCCCAGCCCGCCGGGGCCGTGCCCGTGCCCGCTG
CGTCAGGCGTGGGGATCCCTCGACGCGCTCATCGGCCGCCTCCGCGCCGCGTACGAGGAG
AGCGGCGGCACGCCCGAGTCCAACCCGTTCGCCGCGCGCGCCGTCCGGATCTACCTCCGC
GAGGTGCGGGACTCGCAGGCCAAGGCGCGCGGCATCCCGTACGAGAAGAAGAAGCGCAAG
CGCTCGCAGGCGGCGCAGCCCGCCGGCGTCGAGCCGTCCGGCTCGTCTTCTGCTGCAGCT
GCAGCTGCCGGTGGTGGAGACGCGGGCAGCGGTGGCGGTGCAGCTGCTACTACCACAGCT
CAACCTGGAGGGAGTGGCACTGCACCAAGCGCCTCCTGA

Protein

212 aa

>Os01t0828900-00 Similar to predicted protein.
MDPSGPGPSSAAAGGAPAVAAAPQPPAQLSRYESQKRRDWNTFLQYLRNHRPPLTLARCS
GAHVIEFLRYLDQFGKTKVHASGCAFYGQPSPPGPCPCPLRQAWGSLDALIGRLRAAYEE
SGGTPESNPFAARAVRIYLREVRDSQAKARGIPYEKKKRKRSQAAQPAGVEPSGSSSAAA
AAAGGGDAGSGGGAAATTTAQPGGSGTAPSAS*

CDS

chr01:35473695..35474333 (- strand) : 639 bp

FASTA

>Os01t0828900-00 class=Sequence position=chr01:35473695..35474333 (- strand)
ATGGATCCGT CTGGCCCCGG TCCGTCCTCT GCGGCGGCTG GCGGCGCGCC GGCCGTGGCG GCGGCGCCGC AGCCGCCGGC
GCAGCTGAGC AGGTACGAGT CGCAGAAGCG GAGGGACTGG AACACGTTCC TGCAGTACCT GCGGAACCAC CGGCCGCCGC
TGACGCTGGC GCGGTGCAGC GGCGCGCACG TGATCGAGTT CCTGAGGTAC CTGGACCAGT TCGGGAAGAC CAAGGTGCAC
GCGTCGGGGT GCGCCTTCTA CGGCCAGCCC AGCCCGCCGG GGCCGTGCCC GTGCCCGCTG CGTCAGGCGT GGGGATCCCT
CGACGCGCTC ATCGGCCGCC TCCGCGCCGC GTACGAGGAG AGCGGCGGCA CGCCCGAGTC CAACCCGTTC GCCGCGCGCG
CCGTCCGGAT CTACCTCCGC GAGGTGCGGG ACTCGCAGGC CAAGGCGCGC GGCATCCCGT ACGAGAAGAA GAAGCGCAAG
CGCTCGCAGG CGGCGCAGCC CGCCGGCGTC GAGCCGTCCG GCTCGTCTTC TGCTGCAGCT GCAGCTGCCG GTGGTGGAGA
CGCGGGCAGC GGTGGCGGTG CAGCTGCTAC TACCACAGCT CAACCTGGAG GGAGTGGCAC TGCACCAAGC GCCTCCTGA

Locus: Os01g0828900

Loading...

Locus: Os01g0828900

Loading...