Os01t0829900-01

Locus

Os01g0829900

Description

Iron(III)-deoxymugineic acid transporter, Translocation of iron in reproductive organs and phloem in joints

RAP-DB Gene Symbol Synonym(s)

YSL18, OsYSL18, OsYs2

RAP-DB Gene Name Synonym(s)

YELLOW STRIP-LIKE GENE 18, rice YSL (yellow stripe-like) gene 18, Probable metal-nicotianamine transporter YSL18, Protein YELLOW STRIPE LIKE 18, yellow stripe 1-like transporter 18

CGSNL Gene Symbol

YSL18

CGSNL Gene Name

YELLOW STRIP-LIKE GENE 18

Oryzabase Gene Symbol Synonym(s)

OsYSL18, OsYs2

Oryzabase Gene Name Synonym(s)

rice YSL (yellow stripe-like) gene 18, Probable metal-nicotianamine transporter YSL18, Protein YELLOW STRIPE LIKE 18, yellow stripe 1-like transporter 18

Transcript Evidence

AB190926

AK070618

Protein Evidence

Q941V3

Literature

PMID: 19468840

Note

Manual Curation

June 23, 2014

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter, OPT superfamily (IPR004813)

Full-length cDNA

J023063A19 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0829900-01)

Others

Oryzabase (8359)

KEGG (Os01t0829900-01)

Transcript

2505 bp

>Os01t0829900-01 Iron(III)-deoxymugineic acid transporter, Translocation of iron in reproductive organs and phloem in joints
GCAGTGACACCTCCAAATCTAACATTTCGCGGTTGCATTACCATCTCTTGCCTCTTGGGC
TCTGCCAAGAATAGCCAAAGCATATGTAGCCTTCCTGCCTCTCGTGTTCACTCGTTCGGT
CCTCTTCCTCCGTTCTCCTCTTCCCCTTGCCCTCCTCCAGATCGACCATCACTTGCATGC
ATGCGCAGGCACGATCGAACGCAGTAGATGCATTGGCTGCCAGCTCGATCCGCACCGACG
ATACTCCGGCGAGGCAAAGCGCGGCGTAAGGAGGAGGAGGAAAAGTGGCCGGGATGGAGT
CGGTCGGCGACCCGCGGGATGGGCCGTCGACGGAGCGCGCGTTCGAGGGGCAGCCCGTCC
CGCCGTGGACGGAGCAGGTGACGCTGCGCGCCGTGGTGGCGAGCGTGGCGCTGGGCGTGG
CCCTGAGCAGCGTGATGATGAACCTGGTGTTCACGTCGGGGATCATCCCGTCGCTCAACA
TCTCCGCCGGCCTCCTCGGCTTCTTCCTCCTCAAGGCCTGGACGCGCCTGCTCGACCAGC
TCGGCTCGCCGGGCCGCCCCTTCACCCGCCAGGAGAACGCCGTCGTCCAGACCTGCGTCG
TCGCCTGCGCCAGCATGACATACAGCGGTGGGTTTGGATCGTATCTGCTGGCCATGGATC
GGAAGACGGCGGAGAAGACGAGCACCGGGGACGACTCCAGCGCGAGCGTCAGTGAGCCGG
AGTTCGGTCGGATGATGGCCTTCTTCTTCCTCGTTAGCTTCGTCGGTCTCCTCGCCATTG
TCCCCATGAGGAAGACAATGATCATCCGCCACCGGCTGACGTTCCCAAGCGGCTCGGCGA
CGGCTCACCTCATCAACAGCTTCCATACCCCTCACGGCGCTAGACAAGCGAAGAGGCAAG
TCTCGCTCGTTCTCCGGTCGTCGTTGGCGAGCTTGTTCTGGTCCATCTTCCAGTGGTTCT
ACACCGGAGGTCCAAACTGCGGCTTCACTTCCTTCCCAACGTTTGGGCTCAGCGCCTTCA
ATCGCGGTTTCTACATCAGTTTGAACGGAACTTATGTGGGAATCGGGATGATCAGTCCTC
ACCTGATAAACGTCTCGATGCTCTTCGGGTCCATCATCTCCTGGGGGATCATGCGGCCGT
ACATCCGGAGCAAAAGAGGAATCTGGTACGACGCCGATCTCCAGGAGACGAACTTGAAGA
GCTTCAGTGGATACAAGGTGTTTTGCGCCATAGCAATGATCCTCGGCGACGGCATCTTCC
AGCTCGTCGCGATCTCGCTGAGGACGATACACACGGTGCGCCACCACCAGGTAGCGGCGG
AGACGCTCAGGTCCTTCTCCGACGTCGACGCCATGCCGCGGccggtgatgagcttcgacg
accgccgcaggacgcaggtgttcctcagggagcacatcccgagcaccttcgccatcagcg
ggtacgtcgtcctggccaccgtctccaccgtcgtcatcccgctcatgtacggccaggtga
ggtactaccacgtcgccgccgcgtacgcgttcgcgcccgtcctggccttctgcaacgcct
acggcacgggcgtcgcggagaccaacttctcggcgcagtacaacaagctggtgatcctca
tgttcgcgtcgtggatcgggatcaagaacggcgggatcgtcgggagcctcgtcatctgcg
gcatcgtgtcgtccatcgtctccaccgcctccgacttcatgtcggacttcaagacgagct
acctgacgctcacctcgccgcgggccacgctggtgagccaggtgatcggcacggcgatgg
ggtgcgtcgtcaacccggccgtgttcaccgtcttccaccacTTCTACGAGATGAACCCCA
ACAAGACGTACCAGGCGCCGCTGGCCAAGATCTACCGGGGCATCGCCGTGCTCGGCGCCG
GCGGCCTCGAGCTGCCCAAGTACTGCCTCGCCATCAGCGCCACCTTCTTCGTGCTGGCGC
TGGCCGTCTGCGCGATGCGGGAGGTGGCCGCGCACGGCAAGTGGCGCGCCGAGCCGTACA
TCCCGAGCGTCACCGGCATGGCCGTGTCGTTCCTGCTGGTGCCGGCGGTGTCCATCGACA
TGTGCATCGGCAGCCTGATCGTGTTCCTGTGGAACCGCAACGACAAGCTGGGATCGCAGG
TGTTCGGGCCGGTGCTGGCGTCCGGGCTCATCTGCGGCGACGGCCTCTTCTCCATACCGT
ACGCGCTGCTCGCGAGGTACGACGTCACGCCGCCCATCTGCATCAGGTTCCTCGGCCGGG
TGCAGAACGACAAGCTGGACGCTTTCTTGGCGAGTAAGGCTAAAGCTGGATGATCCTGAA
TTCTTGATCGAGGAAGAAGTGGGCACAATTGTTTATTCCGTTCTTTTTCTTCCAACACCT
GTAGATTATTTAGTGATAGAACTGATCTTTTCATGTAGAGCGAAATGGACTTTTTGTGCT
TTTCAAACAGTTGAGATTTCAATCCAACGAACATACTATGGCAGC

CDS

2040 bp

>Os01t0829900-01 Iron(III)-deoxymugineic acid transporter, Translocation of iron in reproductive organs and phloem in joints
ATGGAGTCGGTCGGCGACCCGCGGGATGGGCCGTCGACGGAGCGCGCGTTCGAGGGGCAG
CCCGTCCCGCCGTGGACGGAGCAGGTGACGCTGCGCGCCGTGGTGGCGAGCGTGGCGCTG
GGCGTGGCCCTGAGCAGCGTGATGATGAACCTGGTGTTCACGTCGGGGATCATCCCGTCG
CTCAACATCTCCGCCGGCCTCCTCGGCTTCTTCCTCCTCAAGGCCTGGACGCGCCTGCTC
GACCAGCTCGGCTCGCCGGGCCGCCCCTTCACCCGCCAGGAGAACGCCGTCGTCCAGACC
TGCGTCGTCGCCTGCGCCAGCATGACATACAGCGGTGGGTTTGGATCGTATCTGCTGGCC
ATGGATCGGAAGACGGCGGAGAAGACGAGCACCGGGGACGACTCCAGCGCGAGCGTCAGT
GAGCCGGAGTTCGGTCGGATGATGGCCTTCTTCTTCCTCGTTAGCTTCGTCGGTCTCCTC
GCCATTGTCCCCATGAGGAAGACAATGATCATCCGCCACCGGCTGACGTTCCCAAGCGGC
TCGGCGACGGCTCACCTCATCAACAGCTTCCATACCCCTCACGGCGCTAGACAAGCGAAG
AGGCAAGTCTCGCTCGTTCTCCGGTCGTCGTTGGCGAGCTTGTTCTGGTCCATCTTCCAG
TGGTTCTACACCGGAGGTCCAAACTGCGGCTTCACTTCCTTCCCAACGTTTGGGCTCAGC
GCCTTCAATCGCGGTTTCTACATCAGTTTGAACGGAACTTATGTGGGAATCGGGATGATC
AGTCCTCACCTGATAAACGTCTCGATGCTCTTCGGGTCCATCATCTCCTGGGGGATCATG
CGGCCGTACATCCGGAGCAAAAGAGGAATCTGGTACGACGCCGATCTCCAGGAGACGAAC
TTGAAGAGCTTCAGTGGATACAAGGTGTTTTGCGCCATAGCAATGATCCTCGGCGACGGC
ATCTTCCAGCTCGTCGCGATCTCGCTGAGGACGATACACACGGTGCGCCACCACCAGGTA
GCGGCGGAGACGCTCAGGTCCTTCTCCGACGTCGACGCCATGCCGCGGccggtgatgagc
ttcgacgaccgccgcaggacgcaggtgttcctcagggagcacatcccgagcaccttcgcc
atcagcgggtacgtcgtcctggccaccgtctccaccgtcgtcatcccgctcatgtacggc
caggtgaggtactaccacgtcgccgccgcgtacgcgttcgcgcccgtcctggccttctgc
aacgcctacggcacgggcgtcgcggagaccaacttctcggcgcagtacaacaagctggtg
atcctcatgttcgcgtcgtggatcgggatcaagaacggcgggatcgtcgggagcctcgtc
atctgcggcatcgtgtcgtccatcgtctccaccgcctccgacttcatgtcggacttcaag
acgagctacctgacgctcacctcgccgcgggccacgctggtgagccaggtgatcggcacg
gcgatggggtgcgtcgtcaacccggccgtgttcaccgtcttccaccacTTCTACGAGATG
AACCCCAACAAGACGTACCAGGCGCCGCTGGCCAAGATCTACCGGGGCATCGCCGTGCTC
GGCGCCGGCGGCCTCGAGCTGCCCAAGTACTGCCTCGCCATCAGCGCCACCTTCTTCGTG
CTGGCGCTGGCCGTCTGCGCGATGCGGGAGGTGGCCGCGCACGGCAAGTGGCGCGCCGAG
CCGTACATCCCGAGCGTCACCGGCATGGCCGTGTCGTTCCTGCTGGTGCCGGCGGTGTCC
ATCGACATGTGCATCGGCAGCCTGATCGTGTTCCTGTGGAACCGCAACGACAAGCTGGGA
TCGCAGGTGTTCGGGCCGGTGCTGGCGTCCGGGCTCATCTGCGGCGACGGCCTCTTCTCC
ATACCGTACGCGCTGCTCGCGAGGTACGACGTCACGCCGCCCATCTGCATCAGGTTCCTC
GGCCGGGTGCAGAACGACAAGCTGGACGCTTTCTTGGCGAGTAAGGCTAAAGCTGGATGA

Protein

679 aa

>Os01t0829900-01 Iron(III)-deoxymugineic acid transporter, Translocation of iron in reproductive organs and phloem in joints
MESVGDPRDGPSTERAFEGQPVPPWTEQVTLRAVVASVALGVALSSVMMNLVFTSGIIPS
LNISAGLLGFFLLKAWTRLLDQLGSPGRPFTRQENAVVQTCVVACASMTYSGGFGSYLLA
MDRKTAEKTSTGDDSSASVSEPEFGRMMAFFFLVSFVGLLAIVPMRKTMIIRHRLTFPSG
SATAHLINSFHTPHGARQAKRQVSLVLRSSLASLFWSIFQWFYTGGPNCGFTSFPTFGLS
AFNRGFYISLNGTYVGIGMISPHLINVSMLFGSIISWGIMRPYIRSKRGIWYDADLQETN
LKSFSGYKVFCAIAMILGDGIFQLVAISLRTIHTVRHHQVAAETLRSFSDVDAMPRPVMS
FDDRRRTQVFLREHIPSTFAISGYVVLATVSTVVIPLMYGQVRYYHVAAAYAFAPVLAFC
NAYGTGVAETNFSAQYNKLVILMFASWIGIKNGGIVGSLVICGIVSSIVSTASDFMSDFK
TSYLTLTSPRATLVSQVIGTAMGCVVNPAVFTVFHHFYEMNPNKTYQAPLAKIYRGIAVL
GAGGLELPKYCLAISATFFVLALAVCAMREVAAHGKWRAEPYIPSVTGMAVSFLLVPAVS
IDMCIGSLIVFLWNRNDKLGSQVFGPVLASGLICGDGLFSIPYALLARYDVTPPICIRFL
GRVQNDKLDAFLASKAKAG*

5'UTR

chr01:35504760..35505052 (- strand) : 293 bp

CDS

chr01:35504426..35504759 (- strand) : 334 bp

chr01:35504148..35504314 (- strand) : 167 bp

chr01:35503949..35504046 (- strand) : 98 bp

chr01:35503729..35503863 (- strand) : 135 bp

chr01:35503391..35503580 (- strand) : 190 bp

chr01:35502168..35503283 (- strand) : 1116 bp

3'UTR

chr01:35501996..35502167 (- strand) : 172 bp

FASTA

>Os01t0829900-01 class=Sequence position=chr01:35501996..35505052 (- strand)
GCAGTGACAC CTCCAAATCT AACATTTCGC GGTTGCATTA CCATCTCTTG CCTCTTGGGC TCTGCCAAGA ATAGCCAAAG
CATATGTAGC CTTCCTGCCT CTCGTGTTCA CTCGTTCGGT CCTCTTCCTC CGTTCTCCTC TTCCCCTTGC CCTCCTCCAG
ATCGACCATC ACTTGCATGC ATGCGCAGGC ACGATCGAAC GCAGTAGATG CATTGGCTGC CAGCTCGATC CGCACCGACG
ATACTCCGGC GAGGCAAAGC GCGGCGTAAG GAGGAGGAGG AAAAGTGGCC GGGATGGAGT CGGTCGGCGA CCCGCGGGAT
GGGCCGTCGA CGGAGCGCGC GTTCGAGGGG CAGCCCGTCC CGCCGTGGAC GGAGCAGGTG ACGCTGCGCG CCGTGGTGGC
GAGCGTGGCG CTGGGCGTGG CCCTGAGCAG CGTGATGATG AACCTGGTGT TCACGTCGGG GATCATCCCG TCGCTCAACA
TCTCCGCCGG CCTCCTCGGC TTCTTCCTCC TCAAGGCCTG GACGCGCCTG CTCGACCAGC TCGGCTCGCC GGGCCGCCCC
TTCACCCGCC AGGAGAACGC CGTCGTCCAG ACCTGCGTCG TCGCCTGCGC CAGCATGACA TACAGCGGTA CGCCACCGCG
CGCGACACGA CGCCGCGCTC TTGCCTCTTC CTGCATTGCC TCTTCCATTG ATCTCGCCGT CGTAACGCCG ACGTCGCTGG
CGGCTGGCCT GTTCTTAGGT GGGTTTGGAT CGTATCTGCT GGCCATGGAT CGGAAGACGG CGGAGAAGAC GAGCACCGGG
GACGACTCCA GCGCGAGCGT CAGTGAGCCG GAGTTCGGTC GGATGATGGC CTTCTTCTTC CTCGTTAGCT TCGTCGGTCT
CCTCGCCATT GTCCCCATGA GGAAGGTACG ATCCACGAAC GCACCTAAAA ATACAAAAAA AAAAAGAAGA AGAAGAGATC
ATAGCTCCCT GATTCTTCGC CGATTTACTG GTTCATCCGT CCGTAGACAA TGATCATCCG CCACCGGCTG ACGTTCCCAA
GCGGCTCGGC GACGGCTCAC CTCATCAACA GCTTCCATAC CCCTCACGGC GCTAGACAAG CGAAGTGAGC AGATTATCAC
TAGCTTGGTG AGTTATAGCC ATGTTGTCAC ATGATTTACG GTAATATCTA CGTCTACTTG TGATCACAGG AGGCAAGTCT
CGCTCGTTCT CCGGTCGTCG TTGGCGAGCT TGTTCTGGTC CATCTTCCAG TGGTTCTACA CCGGAGGTCC AAACTGCGGC
TTCACTTCCT TCCCAACGTT TGGGCTCAGC GCCTTCAATC GCGGGTAAGC TGAGCCGAGC CTGAGCTAGG CAACGAACCG
AGGAAACCGA CGAATTCGAA CACTGAATTC ATGCAAAGTT TTTATTCGGG CTGGAGAAAT TAATCGATCA TCGGCTTGAG
TGACTTGTGT TTCGTTGTTT GTTGCGTTGC AGTTTCTACA TCAGTTTGAA CGGAACTTAT GTGGGAATCG GGATGATCAG
TCCTCACCTG ATAAACGTCT CGATGCTCTT CGGGTCCATC ATCTCCTGGG GGATCATGCG GCCGTACATC CGGAGCAAAA
GAGGAATCTG GTACGACGCC GATCTCCAGG AGACGAACTT GAAGAGCTTC AGTGGATACA AGGTACTACC AATGATCGAA
TATTTGTTGT TAGACAAAAA AAAAAAAAAG ACGACGTCGA TGATGTGCAT CAAGAATCAG TCAGACTTCA CTTTGTTGTG
ATCGAGAAGG TGTTTTGCGC CATAGCAATG ATCCTCGGCG ACGGCATCTT CCAGCTCGTC GCGATCTCGC TGAGGACGAT
ACACACGGTG CGCCACCACC AGGTAGCGGC GGAGACGCTC AGGTCCTTCT CCGACGTCGA CGCCATGCCG CGGccggtga
tgagcttcga cgaccgccgc aggacgcagg tgttcctcag ggagcacatc ccgagcacct tcgccatcag cgggtacgtc
gtcctggcca ccgtctccac cgtcgtcatc ccgctcatgt acggccaggt gaggtactac cacgtcgccg ccgcgtacgc
gttcgcgccc gtcctggcct tctgcaacgc ctacggcacg ggcgtcgcgg agaccaactt ctcggcgcag tacaacaagc
tggtgatcct catgttcgcg tcgtggatcg ggatcaagaa cggcgggatc gtcgggagcc tcgtcatctg cggcatcgtg
tcgtccatcg tctccaccgc ctccgacttc atgtcggact tcaagacgag ctacctgacg ctcacctcgc cgcgggccac
gctggtgagc caggtgatcg gcacggcgat ggggtgcgtc gtcaacccgg ccgtgttcac cgtcttccac cacTTCTACG
AGATGAACCC CAACAAGACG TACCAGGCGC CGCTGGCCAA GATCTACCGG GGCATCGCCG TGCTCGGCGC CGGCGGCCTC
GAGCTGCCCA AGTACTGCCT CGCCATCAGC GCCACCTTCT TCGTGCTGGC GCTGGCCGTC TGCGCGATGC GGGAGGTGGC
CGCGCACGGC AAGTGGCGCG CCGAGCCGTA CATCCCGAGC GTCACCGGCA TGGCCGTGTC GTTCCTGCTG GTGCCGGCGG
TGTCCATCGA CATGTGCATC GGCAGCCTGA TCGTGTTCCT GTGGAACCGC AACGACAAGC TGGGATCGCA GGTGTTCGGG
CCGGTGCTGG CGTCCGGGCT CATCTGCGGC GACGGCCTCT TCTCCATACC GTACGCGCTG CTCGCGAGGT ACGACGTCAC
GCCGCCCATC TGCATCAGGT TCCTCGGCCG GGTGCAGAAC GACAAGCTGG ACGCTTTCTT GGCGAGTAAG GCTAAAGCTG
GATGATCCTG AATTCTTGAT CGAGGAAGAA GTGGGCACAA TTGTTTATTC CGTTCTTTTT CTTCCAACAC CTGTAGATTA
TTTAGTGATA GAACTGATCT TTTCATGTAG AGCGAAATGG ACTTTTTGTG CTTTTCAAAC AGTTGAGATT TCAATCCAAC
GAACATACTA TGGCAGC

Locus: Os01g0829900

Loading...

Locus: Os01g0829900

Loading...