Os01t0831200-01

Locus

Os01g0831200

Description

BAG family protein, Control of innate immunity and broad-spectrum disease resistance

RAP-DB Gene Symbol Synonym(s)

OsBAG4, EIP1

RAP-DB Gene Name Synonym(s)

Bcl-2-associated athanogene 4

CGSNL Gene Symbol

BAG4

CGSNL Gene Name

BCL-2-ASSOCIATED ATHANOGENE 4

Oryzabase Gene Symbol Synonym(s)

OsBAG4, EIP1

Oryzabase Gene Name Synonym(s)

Bcl-2-associated athanogene 4, EBR1-interacting protein 1

Transcript Evidence

AK070208

Protein Evidence

Q5N9K2

Literature

PMID: 27978435

Note

Manual Curation

December 23, 2019

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: chaperone binding (GO:0051087)

Functional domain (InterPro)

Ubiquitin-like domain superfamily (IPR029071)

BAG domain superfamily (IPR036533)

Ubiquitin domain (IPR000626)

BAG domain (IPR003103)

Full-length cDNA

J023047C12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0831200-01)

RiceXPro (AK070208)

Others

Oryzabase (11552)

KEGG (Os01t0831200-01)

Transcript

1158 bp

>Os01t0831200-01 BAG family protein, Control of innate immunity and broad-spectrum disease resistance
AAGTTGTACTTGGCGAAAAAAAAAAAACAGCTCTCGCAAAATCTCGCTGCCGCTGCCGCT
CGCGAGCAAGCTCTACCGCCACTGCCGCGCGGCTGTTCTTGCTTCTCCGGAGGGGAAGGA
ACCCCGCGGGGAGGGAGCCTTCCACCCTTCGCAAAAGCCACGCGCCACCAAATCCTCCTT
TTCTCCTCATCTTCCCTCCATCCCTTCCTCCCTCCGGCCGCGCGTCGCTTTCGCCGCGAC
CGAATCGGTGGGGTCGTGTGGGGGGAGGAGAGGGGCGCCATAAAGGCGGCTGGGGTCGGC
GATGATGAGCGGCGTTGGAGGAGGCAGATCGGGCGGGAGGGACGCGGAGGGCGAGTGGGA
GGTCCGGCCTGGCGGGATGCTGGTGCAGCGCAGGGACGGCGACACGGGTCCGGCCGTCAG
GCTCAGGGTCTCCCACGGCGCCTCCTTCCGCGACGTCGCCGTGCCGGCGCACTCCACCTT
CGGTGAATTGAAGGGGGTCCTTACCCAGGCAACTGGCGTAGAGCCTGAAAGGCAGAGGCT
CTTCTTCCGTGGGAAGGAGAAGAGTGACAATGAGTTCCTGCATACAGCTGGGGTCAAGGA
TGGAGCAAAACTTCTTCTACTTGAGAAGCCTGCCCCTGCCAATGTAGAGCAGAGGGCCGA
GCCAGTAATTATGGATGAGAGCATGATGAAGGCTTGTGAGGCTGTTGGCCGTGTAAGAGC
TGAAGTTGACAGACTCTCTGCCAAGGTATGTGATTTGGAGAAGAGTGTGTTTGCAGGGAG
AAAGATTGAGGATAAAGATTTTGTTGTCTTGACGGAGCTTCTTATGATGGAGCTGCTGAA
ACTTGATGGCATAGAGGCAGAGGGAGAAGCAAGGGCACAAAGGAAGGCTGAGGTACGCCG
TGTCCAAGGTCTTGTGGAGACGTTGGATAAGCTGAAGGCAAGAAATGCCAATCCCTTCAG
CGATCAAAACAAATCTGTTTCAGTGACAACGCAGTGGGAGACGTTCGACAATGGCATGGG
CAGCTTGAATGCACCCCCACCACGGGTTTCTTCCACACAAATAAACACCGACTGGGAGCA
ATTCGACTAGCCTCGGATTGCGTTTTCTCATTGTATCGTTAACTTGTGAGATCAGGTATC
TAAATTCCTTTCACAGGC

CDS

789 bp

>Os01t0831200-01 BAG family protein, Control of innate immunity and broad-spectrum disease resistance
ATGATGAGCGGCGTTGGAGGAGGCAGATCGGGCGGGAGGGACGCGGAGGGCGAGTGGGAG
GTCCGGCCTGGCGGGATGCTGGTGCAGCGCAGGGACGGCGACACGGGTCCGGCCGTCAGG
CTCAGGGTCTCCCACGGCGCCTCCTTCCGCGACGTCGCCGTGCCGGCGCACTCCACCTTC
GGTGAATTGAAGGGGGTCCTTACCCAGGCAACTGGCGTAGAGCCTGAAAGGCAGAGGCTC
TTCTTCCGTGGGAAGGAGAAGAGTGACAATGAGTTCCTGCATACAGCTGGGGTCAAGGAT
GGAGCAAAACTTCTTCTACTTGAGAAGCCTGCCCCTGCCAATGTAGAGCAGAGGGCCGAG
CCAGTAATTATGGATGAGAGCATGATGAAGGCTTGTGAGGCTGTTGGCCGTGTAAGAGCT
GAAGTTGACAGACTCTCTGCCAAGGTATGTGATTTGGAGAAGAGTGTGTTTGCAGGGAGA
AAGATTGAGGATAAAGATTTTGTTGTCTTGACGGAGCTTCTTATGATGGAGCTGCTGAAA
CTTGATGGCATAGAGGCAGAGGGAGAAGCAAGGGCACAAAGGAAGGCTGAGGTACGCCGT
GTCCAAGGTCTTGTGGAGACGTTGGATAAGCTGAAGGCAAGAAATGCCAATCCCTTCAGC
GATCAAAACAAATCTGTTTCAGTGACAACGCAGTGGGAGACGTTCGACAATGGCATGGGC
AGCTTGAATGCACCCCCACCACGGGTTTCTTCCACACAAATAAACACCGACTGGGAGCAA
TTCGACTAG

Protein

263 aa

>Os01t0831200-01 BAG family protein, Control of innate immunity and broad-spectrum disease resistance
MMSGVGGGRSGGRDAEGEWEVRPGGMLVQRRDGDTGPAVRLRVSHGASFRDVAVPAHSTF
GELKGVLTQATGVEPERQRLFFRGKEKSDNEFLHTAGVKDGAKLLLLEKPAPANVEQRAE
PVIMDESMMKACEAVGRVRAEVDRLSAKVCDLEKSVFAGRKIEDKDFVVLTELLMMELLK
LDGIEAEGEARAQRKAEVRRVQGLVETLDKLKARNANPFSDQNKSVSVTTQWETFDNGMG
SLNAPPPRVSSTQINTDWEQFD*

5'UTR

chr01:35582280..35582580 (+ strand) : 301 bp

CDS

chr01:35582581..35582761 (+ strand) : 181 bp

chr01:35583624..35583886 (+ strand) : 263 bp

chr01:35583982..35584128 (+ strand) : 147 bp

chr01:35585310..35585507 (+ strand) : 198 bp

3'UTR

chr01:35585508..35585575 (+ strand) : 68 bp

FASTA

>Os01t0831200-01 class=Sequence position=chr01:35582280..35585575 (+ strand)
AAGTTGTACT TGGCGAAAAA AAAAAAACAG CTCTCGCAAA ATCTCGCTGC CGCTGCCGCT CGCGAGCAAG CTCTACCGCC
ACTGCCGCGC GGCTGTTCTT GCTTCTCCGG AGGGGAAGGA ACCCCGCGGG GAGGGAGCCT TCCACCCTTC GCAAAAGCCA
CGCGCCACCA AATCCTCCTT TTCTCCTCAT CTTCCCTCCA TCCCTTCCTC CCTCCGGCCG CGCGTCGCTT TCGCCGCGAC
CGAATCGGTG GGGTCGTGTG GGGGGAGGAG AGGGGCGCCA TAAAGGCGGC TGGGGTCGGC GATGATGAGC GGCGTTGGAG
GAGGCAGATC GGGCGGGAGG GACGCGGAGG GCGAGTGGGA GGTCCGGCCT GGCGGGATGC TGGTGCAGCG CAGGGACGGC
GACACGGGTC CGGCCGTCAG GCTCAGGGTC TCCCACGGCG CCTCCTTCCG CGACGTCGCC GTGCCGGCGC ACTCCACCTT
CGGTATGATC CTCGCCTCCT CCCTCCTCGT GAAACTCGCC GTGGGCGATT GCAACGAGGG TGCCTTGTGA TCGGTTATGT
TTCGATTAGT ATTTTTGATG TAGGCAAGCT CAAACGCTTG CCCGGAAAGT GCACGACGAA TTGCCGCTCC CGGTTAGTTA
CAGCAGCGAC CACCATGCTC GATCTGCTAT GTTGCACTTG AGCTACGGAT CTTGACCAGT CAACCCGGCG ATTCGTCGAG
GAGTTAATAA GATCACATCG TCCTTGTCTC CTTTTCCGTG AATCGAATTG GATGCAAATC TAGATTCAGA ACAAAAGCAT
TGCAATACTA TGTGCTTGTG TGGCAGGGGG CAGGCAGATG GATTATGGTC CTGCTCTTTT AACTATAATA TCCTCTTGGA
CTGTGGCAAG CAGATGTACC TAGGTATATG GCGACAAAAA TATACTAGTT TTTAAGTGTA TATTTGACGA CATGTCTGTG
CGTCATGCTA TATCCGTCCA CCATTAGGCC CACACTGAAT TACTGTTGTA CCGCTGTATT TGTACACTTC TGTTCATTCA
TGACGTTAAA ACTGTTGTAC CGTTGTATTG TATTAGTACA CTCCTGTTCA TTCATGACGT TAAATAGGTG CACATACTGG
CTCAACTGAG GTTGTGTGAT TTACTAAATT TACACTATTT TATCATTTTC TGTACAGATG GAAGCTCAAT GTTATATAGT
TCAACGTTTG AAAGAAGCCT TCTCTTATCG AATTTTTGGA GTAGTTCGCA GAAGCAGTAC ATCATGATCT GCTTCCTTAG
AAGGAACTGG TTTCCATTGC TTTGATATGT AGTTAGGATT AATTGTTCAC TCTTTTGTAT GAAGGTGAAT TGAAGGGGGT
CCTTACCCAG GCAACTGGCG TAGAGCCTGA AAGGCAGAGG CTCTTCTTCC GTGGGAAGGA GAAGAGTGAC AATGAGTTCC
TGCATACAGC TGGGGTCAAG GATGGAGCAA AACTTCTTCT ACTTGAGAAG CCTGCCCCTG CCAATGTAGA GCAGAGGGCC
GAGCCAGTAA TTATGGATGA GAGCATGATG AAGGCTTGTG AGGCTGTTGG CCGTGTAAGA GCTGAAGTTG ACAGACTCTC
TGCCAAGGTG AAGGAATAAT GTTTCTCCAG CCTCTTCCAT TAAACATTAA CTCTTCTTAT ATCTTGATGC TGATACGGTT
TTTGTTTTTG TTCTATTACC AGGTATGTGA TTTGGAGAAG AGTGTGTTTG CAGGGAGAAA GATTGAGGAT AAAGATTTTG
TTGTCTTGAC GGAGCTTCTT ATGATGGAGC TGCTGAAACT TGATGGCATA GAGGCAGAGG GAGAAGCAAG GGCACAAAGG
AAGGCTGAGG TACAGTGGCC ATTATACATC TCAACATGAT TGGTCATGGC TTATCTCATA TAATACAAAT TCAATTACTA
GTACTGGTGC TGAAATATTG GTCATCCTAA GCTTTCAAAA TGGTTTATTT TCTGTTGATA AATAGCTATC ACATACTATT
ACTCAAACCT GATTTCCTTT TATTTACTAA AATTTAACCA CACACACCTA TGCTGATGAT GGAATTTTCC TGATGAATCA
ACATACATCT ATGCTGATGA TGGAATTTTT TTGTTCCTTA CCATGTAGTG TAGCATTGCT ACCCTGTAAT GATAAATCTT
ATTAATGCCC TTTATAGGAC CATGGCTTAA AAGCCATGAA AAGACAATAC ATACGGCACA TCTAGTAAAG AAAGCTTGCC
ATTTAGCTAT TTTCTGCTAT GCTGAATCAA TTATAGTCTT CATTTGCATC ACAAGGGTGT CTCCCAACTC CTTCCAGGAC
TAATTCTAGT TTCTTTGTTT GACTTTGACC TTCCCCCGTA CTCCAATGAT TATTTTCTTG GTTATGGGTA ATGAACTAGT
TGTGTGGCTT GAGCAGTTCC ACATTAAGAC GGTCCATTTA GCCTTAGGCT TGTAACCAGT ATAGCACAAA ACTATTTTAA
CTTGGCTGTG TGGTTTGAAT CCAGCTTCTA ATGCAAAACC TGCTGGAGCT TATACTTAAT AAATGCCTGG TCTGATATGG
GATAGACCTG AGGTTTATAA CCATTTATTA GTGTTGGTTT CGAGAGAATT TTGCCAGATT AGGACCTTTG TTGGTCAAGA
GTGAAATGCT ATTTGTAGCT TCCTCACTTT TTTGTTGCCC TATTATATTG AAGAACAAGA CCAGTGAAAT GGTCAGCATG
CGCAGGGTGC TTCAAAAACA TTGTTGAGCC AAGCTTAATC GGTAGAACAT CTTATATGTA TTGTAACATA TTAATAAAGT
CAAAATTCAT TTGTTTCTTC AGTTTAAAGA ATCCTTATTT TGCCCTTTTG AATTTTATGG AGTTGGTTTG GTTGCTTGAC
GGTAATATAT CTGAATAATT GTTGCTGCTA TGACCATCTG ACCACGGGTT TGGTCCCTGT TGCAAAATCT TTTTGTTGTC
ATAAAGTAAT AGTCACTGGA GGCATTGTAT GCTGTACATA CCCTCACAAT AACGATGACT TGCATTGCAG GTACGCCGTG
TCCAAGGTCT TGTGGAGACG TTGGATAAGC TGAAGGCAAG AAATGCCAAT CCCTTCAGCG ATCAAAACAA ATCTGTTTCA
GTGACAACGC AGTGGGAGAC GTTCGACAAT GGCATGGGCA GCTTGAATGC ACCCCCACCA CGGGTTTCTT CCACACAAAT
AAACACCGAC TGGGAGCAAT TCGACTAGCC TCGGATTGCG TTTTCTCATT GTATCGTTAA CTTGTGAGAT CAGGTATCTA
AATTCCTTTC ACAGGC

Locus: Os01g0831200

Loading...

Locus: Os01g0831200

Loading...