Os01t0832000-01

Locus

Os01g0832000

Description

Cytidinediphosphate diacylglycerol synthase, Phospholipid homeostasis, Negative role in hyperosmotic stress tolerance

RAP-DB Gene Symbol Synonym(s)

CDS5, OsCDS5

RAP-DB Gene Name Synonym(s)

Cytidinediphosphate diacylglycerol synthase 5

CGSNL Gene Symbol

CDS5

CGSNL Gene Name

CYTIDINEDIPHOSPHATE-DIACYLGLYCEROL SYNTHASE 5

Oryzabase Gene Symbol Synonym(s)

OsCDS5

Oryzabase Gene Name Synonym(s)

Cytidinediphosphate-diacylglycerol synthase 5

Transcript Evidence

AK061265 (truncated)

Inferred from literature

Protein Evidence

Q5N9J9

Literature

PMID: 29604140

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 14, 2018

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

endoplasmic reticulum (GO:0005783)

Full-length cDNA

006-212-C06(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os01t0832000-01)

RiceXPro (AK061265)

Others

Oryzabase (22471)

KEGG (Os01t0832000-01)

Transcript

1067 bp

>Os01t0832000-01 Cytidinediphosphate diacylglycerol synthase, Phospholipid homeostasis, Negative role in hyperosmotic stress tolerance
GGAACTTGTGGGAGTTTGGGAGCTTCAGAGTTCAGAAATCGGTATGGTCAGTCTCATCAG
TGCCCATCTCCTCTCGCTACCCTCATCCGCGCCGCGCTCTCgcccgcaatcgaggccgcc
cctctcgccgcccgccgccgccgccgccgcctcctgctccttcgacctgccccggccccg
ccgcctcgtcgccgacgggagccggaggaaggggacgatggctgcggcgatcccgcccga
ggcaagcggcctggcccacgacctcgggtccgcggccgtcaccgcaggcgtcgccctcgc
cctcctccgCTTCTTCGAGGAGCTCGCCAAGCGCGGGGTCTTCGAGCAGAAACTCAATAG
AAAACTTGTGCATATAACTATCGGTATGGTATTCTTGCTCTTTTGGCCTCTTTTCAGCTC
AGGAAGCTATGCTCCTTTCCTGGCTGCAGTAGCACCAGGGATTAATATTATAAGGATGCT
TCTGCTGGGGTTAGGAGTAATGAAAAATGAAGCTATGGTAAAATCAATGAGCCGATCTGG
AGACCCGAGGGAACTTCTCAAGGGTCCACTGTATTATGCTACCACTATAACTTTTGCCAC
TTCTATATTCTGGAGAACCTCTCCAATCGCTATAGCCCTTATTTGCAACTTATGTGCTGG
GGACGGAATAGCAGACATAGTGGGGAGACGTCTTGGCCAAGAAAAGCTTCCATACAACCC
CAACAAGTCATATGCAGGCAGCATAGCAATGGCACTAGCTGGTTTCATGGCTTCAATTGG
GTATATGCATTACTTCCAGTCATTCGGTTTCATTGAAGAAAGCTGGTCCTTGGCTTTTGG
CTTCCTTGTTGTTTCTGTAACTGCAGCACTTGTAGAGTCCCATCCCATCAGCACACATTT
GGATGACAACTTGACTGTTCCTTTAACATCATTCCTAGTTGGTAGCCTTGTTTTCTGATG
TTTACCTTTGAAGGAAAATTACTGGGAGATCTTCTGACATGTAAGGAATATTTCAATAAG
GAACTTTGGTTCCAATGGTATGAACAAAATTGCCCACTGGTACTTTT

CDS

915 bp

>Os01t0832000-01 Cytidinediphosphate diacylglycerol synthase, Phospholipid homeostasis, Negative role in hyperosmotic stress tolerance
ATGGTCAGTCTCATCAGTGCCCATCTCCTCTCGCTACCCTCATCCGCGCCGCGCTCTCgc
ccgcaatcgaggccgcccctctcgccgcccgccgccgccgccgccgcctcctgctccttc
gacctgccccggccccgccgcctcgtcgccgacgggagccggaggaaggggacgatggct
gcggcgatcccgcccgaggcaagcggcctggcccacgacctcgggtccgcggccgtcacc
gcaggcgtcgccctcgccctcctccgCTTCTTCGAGGAGCTCGCCAAGCGCGGGGTCTTC
GAGCAGAAACTCAATAGAAAACTTGTGCATATAACTATCGGTATGGTATTCTTGCTCTTT
TGGCCTCTTTTCAGCTCAGGAAGCTATGCTCCTTTCCTGGCTGCAGTAGCACCAGGGATT
AATATTATAAGGATGCTTCTGCTGGGGTTAGGAGTAATGAAAAATGAAGCTATGGTAAAA
TCAATGAGCCGATCTGGAGACCCGAGGGAACTTCTCAAGGGTCCACTGTATTATGCTACC
ACTATAACTTTTGCCACTTCTATATTCTGGAGAACCTCTCCAATCGCTATAGCCCTTATT
TGCAACTTATGTGCTGGGGACGGAATAGCAGACATAGTGGGGAGACGTCTTGGCCAAGAA
AAGCTTCCATACAACCCCAACAAGTCATATGCAGGCAGCATAGCAATGGCACTAGCTGGT
TTCATGGCTTCAATTGGGTATATGCATTACTTCCAGTCATTCGGTTTCATTGAAGAAAGC
TGGTCCTTGGCTTTTGGCTTCCTTGTTGTTTCTGTAACTGCAGCACTTGTAGAGTCCCAT
CCCATCAGCACACATTTGGATGACAACTTGACTGTTCCTTTAACATCATTCCTAGTTGGT
AGCCTTGTTTTCTGA

Protein

305 aa

>Os01t0832000-01 Cytidinediphosphate diacylglycerol synthase, Phospholipid homeostasis, Negative role in hyperosmotic stress tolerance
MVSLISAHLLSLPSSAPRSRPQSRPPLSPPAAAAAASCSFDLPRPRRLVADGSRRKGTMA
AAIPPEASGLAHDLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLLF
WPLFSSGSYAPFLAAVAPGINIIRMLLLGLGVMKNEAMVKSMSRSGDPRELLKGPLYYAT
TITFATSIFWRTSPIAIALICNLCAGDGIADIVGRRLGQEKLPYNPNKSYAGSIAMALAG
FMASIGYMHYFQSFGFIEESWSLAFGFLVVSVTAALVESHPISTHLDDNLTVPLTSFLVG
SLVF*

5'UTR

chr01:35603987..35604029 (- strand) : 43 bp

CDS

chr01:35603681..35603986 (- strand) : 306 bp

chr01:35602277..35602344 (- strand) : 68 bp

chr01:35602073..35602204 (- strand) : 132 bp

chr01:35601726..35601841 (- strand) : 116 bp

chr01:35601506..35601620 (- strand) : 115 bp

chr01:35601251..35601428 (- strand) : 178 bp

3'UTR

chr01:35601142..35601250 (- strand) : 109 bp

FASTA

>Os01t0832000-01 class=Sequence position=chr01:35601142..35604029 (- strand)
GGAACTTGTG GGAGTTTGGG AGCTTCAGAG TTCAGAAATC GGTATGGTCA GTCTCATCAG TGCCCATCTC CTCTCGCTAC
CCTCATCCGC GCCGCGCTCT Cgcccgcaat cgaggccgcc cctctcgccg cccgccgccg ccgccgccgc ctcctgctcc
ttcgacctgc cccggccccg ccgcctcgtc gccgacggga gccggaggaa ggggacgatg gctgcggcga tcccgcccga
ggcaagcggc ctggcccacg acctcgggtc cgcggccgtc accgcaggcg tcgccctcgc cctcctccgC TTCTTCGAGG
AGCTCGCCAA GCGCGGGGTC TTCGAGCAGG TCAGCCACCG CCGCCTCTTC GCTTCGCCCT TTCCCCCGTT GGCGCGTCAC
TGGAGGCTTC TAGTAGCTAA ATATCTCCAA CTAAGATGCA TGCTCCCTTA GTAGCCATTA CTATTTGAAT TTCGATGCAA
CAGTAAGGAG GTCGCTACTG AATTACACGC TCACTGACTC ATACTACTGA GATTCCCATG GGTGGGTGAC GAGACAGACA
CGCAGATTTG GATTCGTTTC TCGTATTTTT GCCAAGGTTG CATGTACGAA CAATTATATT TGTGTGATCA TCTTCACGGT
GCTCTGCGCT TCTCCCAAGC AGTACAACTT GTTTGTTAAA ATATTCAGCG CAATTAGTCC CAGCCTCCAA GCTGTACAGG
AGTCCCATAC TGCTAAGTAT TAATTGTGCT CATCTGAGGT GTCTGTTTAG TAGTTTTACT TTGAGATAGG ATTTTTAGGT
GGGGATTAGT GATAAATGGG TAAGCATTTC CATATTCTTC CGAAATAGAC CCTTTCAGTA CAAGTCTAGT TAGTGCCTGT
TAGATTCAAG AAAGATATAA TGGAAAAGGT CCATGGAGAT GCATGTGAAA TATGTCAATT TGATGGTCTA CCGTTATGTT
CTAAGAATTC CAAGTTAAGA ACGAGGAGCG AGGGTTGCGA AGCAAATCCT GATATTTTTG TTCAAGATAT TAAAGCATAT
ATTTAGTGCG AGAAGTAGGC TTATGAGTCT TGTATTTCAT TCCGGTCTCT GTCCCGTGCT GTTCTTTCTT TGATTCTAAA
TAACTTTTAT TTCTCTTAAT GGAAAAAATG CGCCCCTGGG TATTCCCGAA TTTTATGCAG TTTTTATTCA AAAGTATAAT
GTTACCTTTT CTAGTTTCTG TTAACAAGAT TGATCTTTCT ATCCCATTTC CAACACTCGT TTAGAAAAAA AAAATCAAGC
ATGATATTTA AGCCATAAAA CCCCTCAGTG TCTCACTCTG CACATTGCAA CTCTTAAAGT TTTACTTTGC AGCGCATTCA
TGTGAGATAA TCCACCAACT GTTGTTAAAT ATATTTCAGA AATAGTGAAA AATGAAGTAT AAGTTCCCAC CAACAAAAAC
TCAGATTCAC AAAATCTTGG GGTAAATGCA CAGCACAGCC TTCTTACCAG TAATTTCAGA TGGATGTCTG ATGGCTGGCA
TTAGCTCATT GACACCAGAT GAAATTCAGC TAGGTTCTCA ACATAACATA GACATATAAA CTGAACCATG CAATTAGCTG
ACAAATTAAC AGTAGTTTTT CTTATTGAGA TTTGCTTCAA TACGATGATG CTTTCTATTG ATAAATTCCA TTTGTTTGCC
TGCAGAAACT CAATAGAAAA CTTGTGCATA TAACTATCGG TATGGTATTC TTGCTCTTTT GGCCTCTTTT CAGGTAAGAA
AATCTAATTT TCTCTGGTCA ACATAAATCA CCATATTGGT ACTCACATAT TGATGCTTTA TACAGCTCAG GAAGCTATGC
TCCTTTCCTG GCTGCAGTAG CACCAGGGAT TAATATTATA AGGATGCTTC TGCTGGGGTT AGGAGTAATG AAAAATGAAG
CTATGGTAAA ATCAATGAGC CGATCTGGAG ACCCGAGGTT GTATACTCGC ATACACCAAC CTTTGGCGAT TACATAATTA
ATAAGCTTGT TTCTGCTCAT ATTTGCCTTT TATTCTTTGC ATTTTTCACT CTGATTTTCC TTTTTCCTAT TCTATGCCTT
CTTTTTGGCA CAGATTTGCT TATTCTTTGT TTCTGTTGAA TATCTATAGT TGCTGCTGCT GCTGCTTCAG GTCATGATCC
TTTAGACTTC ATTTTCTCAT GAACACAGGG AACTTCTCAA GGGTCCACTG TATTATGCTA CCACTATAAC TTTTGCCACT
TCTATATTCT GGAGAACCTC TCCAATCGCT ATAGCCCTTA TTTGCAACTT ATGTGCTGGG GACGGTATGT GCGTATATCT
CCAGTCCTTA GCTTAGCGTA AACAAGCTAT GCATACTTTC CTTGCTGACA TTCCCTCCCC CCCCCCCCCC CCCCCCACTA
CACTTTCAGG AATAGCAGAC ATAGTGGGGA GACGTCTTGG CCAAGAAAAG CTTCCATACA ACCCCAACAA GTCATATGCA
GGCAGCATAG CAATGGCACT AGCTGGTTTC ATGGCTTCAA TTGGGTAATT ATTTGAGAGG CTTTTACTGA AGTTTTCTGT
TGCATATGTG TTTTTAAGTC ATTCATTCGC ATATTGTTCA GGTATATGCA TTACTTCCAG TCATTCGGTT TCATTGAAGA
AAGCTGGTCC TTGGCTTTTG GCTTCCTTGT TGTTTCTGTA ACTGCAGCAC TTGTAGAGTC CCATCCCATC AGCACACATT
TGGATGACAA CTTGACTGTT CCTTTAACAT CATTCCTAGT TGGTAGCCTT GTTTTCTGAT GTTTACCTTT GAAGGAAAAT
TACTGGGAGA TCTTCTGACA TGTAAGGAAT ATTTCAATAA GGAACTTTGG TTCCAATGGT ATGAACAAAA TTGCCCACTG
GTACTTTT

Locus: Os01g0832000

Loading...

Locus: Os01g0832000

Loading...