Os01t0832900-01

Locus

Os01g0832900

Description

Similar to ATP binding protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSTK1

Oryzabase Gene Name Synonym(s)

serine/threonine kinase 1

Transcript Evidence

AK068489 (DDBJ, Best hit)

Protein Evidence

NP_001148168.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J013155B12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0832900-01)

Others

Oryzabase (18221)

Transcript

2694 bp

>Os01t0832900-01 Similar to ATP binding protein.
CTCTCTTTCTTCTGACTTCTTTTGTGCTTCTTCCAAGCTTCCTTCCAGTCCTCGCTCTCG
TCCTCCCTCCGTCACTCGCAGCGCAGACCAAGGAAGGCTTCTCGCCTCTCGCCTTCGCCT
CGCTTCGCTTCCAAGTCCCAATGCCGACGCAACAGCTTACCTCACGCGGCGCGCCACGCG
CTTGAGAGGGGCCGCCAACCGCATGGCGGCGCCGGGCCTGGACGAGGTCATGGCGTTCCT
CACCGACCACGGGTTCGCGGGCGCCGCCTCCGCGCTCCGCGACGACGTCCTCGCCCGCGC
CGCGTCCGCCGCCGGGGACGCCGGCTCCGATTCCGATGCCGCATTAGATCCCCAGCTCCC
GCCCCTCCGGTTGCCGGCGTCCACGTCCGGAGGCGGTGGGGCGCCGGCGGCGCCGCCTGC
AAGCCCTGGCTCCAGCTCTGACTCGGCGTCGTCCTCTGCCTTCGTCAGCATGCGCTCCTC
GCCCTCAGGGATGCTGAATCCATATGGAGTCTGGTCGCCGCGGCACTCGGACACGTCGTC
ATCGGAGATGGAGTTTGGCACAGCGCGTCAGTACGACGCCACCGACTTCTTTTTCCAAGA
AGGTTGGCTTTACGACGACCATCTCTTCCATAGCAAGTCGGAGCTGGACGACGACAATGG
AGAAGACAAAGAGGAGGACAAGTTTGTTCTTGGTGTCCACGATGGCTCAGGGAGGATAGA
GATGGGAGTGCTTAGTGCCGGTGATGACCACCGTCATGAACATGTTGGCAATGACGGCTG
TGAGGGATGTGCTGAGGTGTACACATGTTCATCACCGCTCTGCGGATGCTGTGGTGAGGG
ACTGAAGAACGGGGGGCTAGAGGTGGTGAAGGATTCTAGCTCCACTGTCTATGGGAGGTA
CCAGATCATTGATGACCAGACAGAGATACTTGATGAGTGTGGCATGGATGGGTTTCAGTT
GAAGCACCCTGCGGATGTTGTGCTTGAGTGTCATTTGCCAAGAGATTCTGGGGAAGGAGA
TGAGCGATCGGAGCTGAGTGTAGTGGAGAAGGAGCTTCAAATGCTCAGTTCATTTGGTAC
TAGGGTTGATGCAGATGCTTTTACAAGTCCTGGACTTGTACACGATATCACAGACAATGC
CAAACTGGATGATAGCATTGAAAAGAATATGAAAAACAGTAGCGACAAATATCTGAAGGA
AGGTTATAGCATAGAGCCTTTCCCTGAGAGTTCTGTTGATGATACCTTTGAGTTTGGAGA
TATTGGACCATTGAATACTGATGCGCAAAACTCAACTGCTGCTAAAGCTGAGGAAGAAAA
TCCAGAGACAAATGTTGATCTCGCTCTCGCTAATTTCCATCGAGAATATGAGGTATTTGA
ACTGAGAATTGTCCACCGCAAGAACAGGACCGGCTTTGAAGTAAGCAAAGATTTCCCCAT
TGTCATAAATTCAGTTATAGCAGGAAGATATTATGTCACTGAATACCTTGGCTCAGCTGC
ATTCAGTAAAGTTGTGCAAGCACATGATCTTCAGACAGGAACTGATGTTTGCCTTAAAAT
AATTAAAAATGATAAGGATTTCTTTGATCAGAGTCTGGATGAGATCAAGCTTCTGAAGTT
TGTGAACAAATACGATCCATTAGATGAGTATCATGTGTTGCGTCTCTATGACTATTTTTA
TCATCAGGAACACCTTTTTATTGTCACTGAATTACTGCGAGCAAATCTATATGAGTTCCA
GAAATATAATCAGGAATCTGGTGGTGAAGCATACTTCACATTGCCTAGAATACAGGCAAT
AGCTCGGCAATGTTTAGAAGCCTTGGTATATTTGCATCATTTAAGGATCATTCATTGTGA
CCTGAAGCCTGAAAACATCCTTATCAAGAGCTACAGCAGATGTGAAATTAAGGTTATCGA
TCTTGGAAGTAGTTGCTTCTTGACAGACAACTTATGTCTCTATGTACAATCACGGTCATA
TCGAGCTCCTGAGGTCATTCTGGGGCTTCCTTATGATCAGAGGATTGATATTTGGTCTCT
TGGTTGCATCCTTGCGGAACTCTACACTGGTGAGGTACTATTTCCTAATGAACCAGTGCC
CATAATGCTTGCTCAAATGATTGGGATAATTGGCCCAATTGACATGGAAATGCTTGCCCT
GGGAGAGGAGACGCAAAAGTATTTCACTGATGATTACGACCTTTTCACCAAGAATGAGGA
AACAGATCAATTCGAGTATTTGATCCCAGAAAAGTCTTCTCTGCAGCATCACTTACAATG
CCCTGATTCAGAGTTTGTTGATTTTCTATCCTATTTGCTGCAAATAAACCCCAGGAGAAG
ACCAACGGCAAGTGAAGCGCTACAACATCAATGGCTTTCATTTGCATACTAATGACTAAT
GAGAAACCAACAGGTCATTTCGTTTGTTTTAAGTGCTTTGTTCAACTGCTCCTAAGCTGG
ATCCCTGCAATCTTCTAAAGATGGATTGATTTTCTGATGTTTCCCCATGAGTCCATGACA
TGAAACATTTTACACTTTCCTTGAGTTTTAGAAGGATTTACCTTTGTGCTTGCTGAACTA
GCATGCGGCACAATTTTCTTGTTTCGTTTCTTCAGGGCAATTCTTGGAGTGGAAGCCCTG
CTCTCAGTGTTAAGATTCGTGAGTGTATGTAAATATGAGGAAATTTTCCTGTGT

CDS

2190 bp

>Os01t0832900-01 Similar to ATP binding protein.
ATGGCGGCGCCGGGCCTGGACGAGGTCATGGCGTTCCTCACCGACCACGGGTTCGCGGGC
GCCGCCTCCGCGCTCCGCGACGACGTCCTCGCCCGCGCCGCGTCCGCCGCCGGGGACGCC
GGCTCCGATTCCGATGCCGCATTAGATCCCCAGCTCCCGCCCCTCCGGTTGCCGGCGTCC
ACGTCCGGAGGCGGTGGGGCGCCGGCGGCGCCGCCTGCAAGCCCTGGCTCCAGCTCTGAC
TCGGCGTCGTCCTCTGCCTTCGTCAGCATGCGCTCCTCGCCCTCAGGGATGCTGAATCCA
TATGGAGTCTGGTCGCCGCGGCACTCGGACACGTCGTCATCGGAGATGGAGTTTGGCACA
GCGCGTCAGTACGACGCCACCGACTTCTTTTTCCAAGAAGGTTGGCTTTACGACGACCAT
CTCTTCCATAGCAAGTCGGAGCTGGACGACGACAATGGAGAAGACAAAGAGGAGGACAAG
TTTGTTCTTGGTGTCCACGATGGCTCAGGGAGGATAGAGATGGGAGTGCTTAGTGCCGGT
GATGACCACCGTCATGAACATGTTGGCAATGACGGCTGTGAGGGATGTGCTGAGGTGTAC
ACATGTTCATCACCGCTCTGCGGATGCTGTGGTGAGGGACTGAAGAACGGGGGGCTAGAG
GTGGTGAAGGATTCTAGCTCCACTGTCTATGGGAGGTACCAGATCATTGATGACCAGACA
GAGATACTTGATGAGTGTGGCATGGATGGGTTTCAGTTGAAGCACCCTGCGGATGTTGTG
CTTGAGTGTCATTTGCCAAGAGATTCTGGGGAAGGAGATGAGCGATCGGAGCTGAGTGTA
GTGGAGAAGGAGCTTCAAATGCTCAGTTCATTTGGTACTAGGGTTGATGCAGATGCTTTT
ACAAGTCCTGGACTTGTACACGATATCACAGACAATGCCAAACTGGATGATAGCATTGAA
AAGAATATGAAAAACAGTAGCGACAAATATCTGAAGGAAGGTTATAGCATAGAGCCTTTC
CCTGAGAGTTCTGTTGATGATACCTTTGAGTTTGGAGATATTGGACCATTGAATACTGAT
GCGCAAAACTCAACTGCTGCTAAAGCTGAGGAAGAAAATCCAGAGACAAATGTTGATCTC
GCTCTCGCTAATTTCCATCGAGAATATGAGGTATTTGAACTGAGAATTGTCCACCGCAAG
AACAGGACCGGCTTTGAAGTAAGCAAAGATTTCCCCATTGTCATAAATTCAGTTATAGCA
GGAAGATATTATGTCACTGAATACCTTGGCTCAGCTGCATTCAGTAAAGTTGTGCAAGCA
CATGATCTTCAGACAGGAACTGATGTTTGCCTTAAAATAATTAAAAATGATAAGGATTTC
TTTGATCAGAGTCTGGATGAGATCAAGCTTCTGAAGTTTGTGAACAAATACGATCCATTA
GATGAGTATCATGTGTTGCGTCTCTATGACTATTTTTATCATCAGGAACACCTTTTTATT
GTCACTGAATTACTGCGAGCAAATCTATATGAGTTCCAGAAATATAATCAGGAATCTGGT
GGTGAAGCATACTTCACATTGCCTAGAATACAGGCAATAGCTCGGCAATGTTTAGAAGCC
TTGGTATATTTGCATCATTTAAGGATCATTCATTGTGACCTGAAGCCTGAAAACATCCTT
ATCAAGAGCTACAGCAGATGTGAAATTAAGGTTATCGATCTTGGAAGTAGTTGCTTCTTG
ACAGACAACTTATGTCTCTATGTACAATCACGGTCATATCGAGCTCCTGAGGTCATTCTG
GGGCTTCCTTATGATCAGAGGATTGATATTTGGTCTCTTGGTTGCATCCTTGCGGAACTC
TACACTGGTGAGGTACTATTTCCTAATGAACCAGTGCCCATAATGCTTGCTCAAATGATT
GGGATAATTGGCCCAATTGACATGGAAATGCTTGCCCTGGGAGAGGAGACGCAAAAGTAT
TTCACTGATGATTACGACCTTTTCACCAAGAATGAGGAAACAGATCAATTCGAGTATTTG
ATCCCAGAAAAGTCTTCTCTGCAGCATCACTTACAATGCCCTGATTCAGAGTTTGTTGAT
TTTCTATCCTATTTGCTGCAAATAAACCCCAGGAGAAGACCAACGGCAAGTGAAGCGCTA
CAACATCAATGGCTTTCATTTGCATACTAA

Protein

730 aa

>Os01t0832900-01 Similar to ATP binding protein.
MAAPGLDEVMAFLTDHGFAGAASALRDDVLARAASAAGDAGSDSDAALDPQLPPLRLPAS
TSGGGGAPAAPPASPGSSSDSASSSAFVSMRSSPSGMLNPYGVWSPRHSDTSSSEMEFGT
ARQYDATDFFFQEGWLYDDHLFHSKSELDDDNGEDKEEDKFVLGVHDGSGRIEMGVLSAG
DDHRHEHVGNDGCEGCAEVYTCSSPLCGCCGEGLKNGGLEVVKDSSSTVYGRYQIIDDQT
EILDECGMDGFQLKHPADVVLECHLPRDSGEGDERSELSVVEKELQMLSSFGTRVDADAF
TSPGLVHDITDNAKLDDSIEKNMKNSSDKYLKEGYSIEPFPESSVDDTFEFGDIGPLNTD
AQNSTAAKAEEENPETNVDLALANFHREYEVFELRIVHRKNRTGFEVSKDFPIVINSVIA
GRYYVTEYLGSAAFSKVVQAHDLQTGTDVCLKIIKNDKDFFDQSLDEIKLLKFVNKYDPL
DEYHVLRLYDYFYHQEHLFIVTELLRANLYEFQKYNQESGGEAYFTLPRIQAIARQCLEA
LVYLHHLRIIHCDLKPENILIKSYSRCEIKVIDLGSSCFLTDNLCLYVQSRSYRAPEVIL
GLPYDQRIDIWSLGCILAELYTGEVLFPNEPVPIMLAQMIGIIGPIDMEMLALGEETQKY
FTDDYDLFTKNEETDQFEYLIPEKSSLQHHLQCPDSEFVDFLSYLLQINPRRRPTASEAL
QHQWLSFAY*

5'UTR

chr01:35653186..35653387 (+ strand) : 202 bp

CDS

chr01:35653388..35653673 (+ strand) : 286 bp

chr01:35654074..35654691 (+ strand) : 618 bp

chr01:35655473..35655773 (+ strand) : 301 bp

chr01:35655878..35656157 (+ strand) : 280 bp

chr01:35656456..35656563 (+ strand) : 108 bp

chr01:35656829..35657107 (+ strand) : 279 bp

chr01:35657546..35657689 (+ strand) : 144 bp

chr01:35657832..35658005 (+ strand) : 174 bp

3'UTR

chr01:35658006..35658307 (+ strand) : 302 bp

FASTA

>Os01t0832900-01 class=Sequence position=chr01:35653186..35658307 (+ strand)
CTCTCTTTCT TCTGACTTCT TTTGTGCTTC TTCCAAGCTT CCTTCCAGTC CTCGCTCTCG TCCTCCCTCC GTCACTCGCA
GCGCAGACCA AGGAAGGCTT CTCGCCTCTC GCCTTCGCCT CGCTTCGCTT CCAAGTCCCA ATGCCGACGC AACAGCTTAC
CTCACGCGGC GCGCCACGCG CTTGAGAGGG GCCGCCAACC GCATGGCGGC GCCGGGCCTG GACGAGGTCA TGGCGTTCCT
CACCGACCAC GGGTTCGCGG GCGCCGCCTC CGCGCTCCGC GACGACGTCC TCGCCCGCGC CGCGTCCGCC GCCGGGGACG
CCGGCTCCGA TTCCGATGCC GCATTAGATC CCCAGCTCCC GCCCCTCCGG TTGCCGGCGT CCACGTCCGG AGGCGGTGGG
GCGCCGGCGG CGCCGCCTGC AAGCCCTGGC TCCAGCTCTG ACTCGGCGTC GTCCTCTGCC TTCGTCAGCA TGCGCTCCTC
GCCCTCAGGT AGTTAGGGGA TCAGGGCACA AGGCTGAATT TTTTTTTTTC ATCATCTCTC AGCGTTAAAC CCATATCTTC
TCGTTTTCCG AGGTCGTCAG TTATGTCGCG CGAAATCTCG ATCTGTGCGC CGATGTTTTT GGCGGCTATG GTTGGCTTTG
GGTCCAATTC GAACCTGCTG GATCAAAGCC AGCATATCTC TGTGCATATG TTCATGGAGG AAAATTGTGA TCTTTTGATC
TAGTAGGGTG CTGGTTAAAC CCCTTCCCCT GGGTTTTGTA CACCAATGAT ACTGCTTGTC GTTAAATTCT GATTTCTCAG
TATAGTTGAG TGTTCTAATT TGCGGATTTG TGGGTGTTTA AGTCACGATT TTGGTCCTAA ATTTGATATA TTTTGTTTGT
GAGATTAGGG ATGCTGAATC CATATGGAGT CTGGTCGCCG CGGCACTCGG ACACGTCGTC ATCGGAGATG GAGTTTGGCA
CAGCGCGTCA GTACGACGCC ACCGACTTCT TTTTCCAAGA AGGTTGGCTT TACGACGACC ATCTCTTCCA TAGCAAGTCG
GAGCTGGACG ACGACAATGG AGAAGACAAA GAGGAGGACA AGTTTGTTCT TGGTGTCCAC GATGGCTCAG GGAGGATAGA
GATGGGAGTG CTTAGTGCCG GTGATGACCA CCGTCATGAA CATGTTGGCA ATGACGGCTG TGAGGGATGT GCTGAGGTGT
ACACATGTTC ATCACCGCTC TGCGGATGCT GTGGTGAGGG ACTGAAGAAC GGGGGGCTAG AGGTGGTGAA GGATTCTAGC
TCCACTGTCT ATGGGAGGTA CCAGATCATT GATGACCAGA CAGAGATACT TGATGAGTGT GGCATGGATG GGTTTCAGTT
GAAGCACCCT GCGGATGTTG TGCTTGAGTG TCATTTGCCA AGAGATTCTG GGGAAGGAGA TGAGCGATCG GAGCTGAGTG
TAGTGGAGAA GGAGCTTCAA ATGCTCAGTT CATTTGGTAC TAGGGTTGAT GCAGATGCTT TTACAAGTAA GTACTTCTGA
AATCTTAAAC TTTCTGCTTG ATTTCACCCT TCAATATTAG TACTCCACTA AATACAGTAT TTGTACTAAT TTTCAACATT
AACCCTCTTT GCTCCGATGA AGATATTATG AATTTATTTA TTGAAGTGGG AGAACAGGGT TGAATTACAG CATTAAAGAG
TTTGGATACT GTTAGGCACC GTTTGGATGC CAGAATTGAA TTGTGTAGTT ATCCCAAAAA AAAAAAGAAt tgaattgtgt
ttgtggaaat ggtggtccaa ttcaaatttc aactataatt ggtgttggga tccaattcaa cttgaATTGT GTATGAGTGG
TGCAGACAAT GCTGAATGAG AGATGTTTTG TTACTGTTGT AAACTGAAAT TTGCTGTTAA ATATGCACAG AGCTAAAAAA
AAATGGTGCA TTTTAGTGGT AACCTCTTCC AGAAACATTA CTGCTGTTAT ACGATTATGC TTCACATGGG TTTTCTCTGT
ATATTAGAAG AATTGAAAAT TTTCTTCTGC TCTTCAATAT AATATGTAAC TTGGTTTTGG TAACACTACA GAAATGAAAT
GAATCTGGAT TTAAAAATGC ACATTTGAGG AGACATTTTT TAACAAAGAA AGGCCAAACC TATTTTATTA TCAGTCTTGC
TGAACTGTTG TTTGTTTACC AACGTTTGTG TGAATTTGCA ATTTAATTCC AGTCATCTTC TTATCCTGTA TAAAGATCAT
TTGCTGCTTG CTTCATTAGG TTTACTGTAA ATGTTTGTTG TCTTTAGGTC CTGGACTTGT ACACGATATC ACAGACAATG
CCAAACTGGA TGATAGCATT GAAAAGAATA TGAAAAACAG TAGCGACAAA TATCTGAAGG AAGGTTATAG CATAGAGCCT
TTCCCTGAGA GTTCTGTTGA TGATACCTTT GAGTTTGGAG ATATTGGACC ATTGAATACT GATGCGCAAA ACTCAACTGC
TGCTAAAGCT GAGGAAGAAA ATCCAGAGAC AAATGTTGAT CTCGCTCTCG CTAATTTCCA TCGAGAATAT GAGGTATTTG
AACTGAGAAT TGTCCACCGC AAGAACAGGT TCACAATCAC TTCTTGTTTC TCCCTTCTCT TCTTCCATTT TTGGTTGCTA
AATGATACTT CCAAGTTAAT TCTTATGCTC ATATAGCATG TCTTCACTGC AGGACCGGCT TTGAAGTAAG CAAAGATTTC
CCCATTGTCA TAAATTCAGT TATAGCAGGA AGATATTATG TCACTGAATA CCTTGGCTCA GCTGCATTCA GTAAAGTTGT
GCAAGCACAT GATCTTCAGA CAGGAACTGA TGTTTGCCTT AAAATAATTA AAAATGATAA GGATTTCTTT GATCAGAGTC
TGGATGAGAT CAAGCTTCTG AAGTTTGTGA ACAAATACGA TCCATTAGAT GAGTATCATG TGTTGCGTCT CTATGACTAT
TTTTATCATC AGGTATATCA CTTAAGAAAT AAAGTTGACT AAGATACTCC CTTTGCATTG ATGTTATGCT GCATACTTTT
TGGCTATTCG GAAGCTAAGG AAGTTTGAAA GGGATATATT GTTGGTCTTT GGCAACTTTG AAAAGGATCT ATGATGGCTA
AAAGCAATAT AGCTTCTTAT TTTCAGTTGA TTTCTTAAAT TGCTTGCATG CTTGTTTAAT TGTAGAAAAA TCATAGAATT
TATTAGTACT TTATTTTTTG CGGTTGCAAA ATCATAGAAT TTCTGTAACG GCATATTGAC ATTGCAACAG GAACACCTTT
TTATTGTCAC TGAATTACTG CGAGCAAATC TATATGAGTT CCAGAAATAT AATCAGGAAT CTGGTGGTGA AGCATACTTC
ACATTGCCTA GAATACAGGT ATGTTTGACC GTTCTATACT AAGATGCTAT CTATAATTGT TGCATATGCA TAGACACTTA
CAGTTCAATT TGTAGTATGC ACGATATGCA ATGTTCCAAA CCAATTTAAT ATGCTTCATT TAAACATAAA GTTTTTGAAC
CGTAATTGAT CATTTTCTTG GAATGATACT GCTGTAAATA AAATGATTAA CTGTTTTAAG TGCAATTAAA TTTAACTTAA
GAAAAAAGGT TTTGATGAAC AAAAGTTCCC CCTTTTCTTT CAGGCAATAG CTCGGCAATG TTTAGAAGCC TTGGTATATT
TGCATCATTT AAGGATCATT CATTGTGACC TGAAGCCTGA AAACATCCTT ATCAAGAGCT ACAGCAGATG TGAAATTAAG
GTTATCGATC TTGGAAGTAG TTGCTTCTTG ACAGACAACT TATGTCTCTA TGTACAATCA CGGTCATATC GAGCTCCTGA
GGTCATTCTG GGGCTTCCTT ATGATCAGAG GATTGATATT TGGTCTCTTG GTTGCATCCT TGCGGAACTC TACACTGGTG
AGGTAAGAAG CTTCTGTACC TTGCTAATCC TTCTTTTTGG ACACGTGCTG ACCTTTTAGC TGTGTTAAAC CCATAGTGGC
CTGTTGTCAT ACAGCACATA GAATTTTATG GAGATTTCAA CACACTGCAT TAATAGTGAA GTGCTGTGTT GGCATGTTTG
ATACCTTCTT TCTTGTCTAA ATGCTATGCA ACATATAGCT CCAAACAGAA AATAGAGATC AAACTTCTGT GCCAGAATTA
TTTTTTTTTG AACGAATGCC TGAGTAAATT TTGGGGCACA AGGACTGGCT TTAATAAATA AAGACAAATA AGAACGTTTT
ACATGGAAAC GAATAATGTG CTTCAAGTTG TTTTGTTGTT ATCCATATGG AAACAAAGTT GTTTTAAAAT TTAAAAATGC
TAATCGTCTA ATTATAATTC CTAACTGGTA CACATAACAG GTACTATTTC CTAATGAACC AGTGCCCATA ATGCTTGCTC
AAATGATTGG GATAATTGGC CCAATTGACA TGGAAATGCT TGCCCTGGGA GAGGAGACGC AAAAGTATTT CACTGATGAT
TACGACCTTT TCACCAAGAA TGAGGTACAC TATTCTTAGT GCTAGTGGAA GTAGCCTTTC CTGTGACCAC TCGAATTTCA
TCATGTCCAT CTCTCTCTGT GGACTGTGCG AGTTATAACA CATTGAACAC TGAACTCATT TTGTTGTTTA CCTCATTTCT
ATTCAGGAAA CAGATCAATT CGAGTATTTG ATCCCAGAAA AGTCTTCTCT GCAGCATCAC TTACAATGCC CTGATTCAGA
GTTTGTTGAT TTTCTATCCT ATTTGCTGCA AATAAACCCC AGGAGAAGAC CAACGGCAAG TGAAGCGCTA CAACATCAAT
GGCTTTCATT TGCATACTAA TGACTAATGA GAAACCAACA GGTCATTTCG TTTGTTTTAA GTGCTTTGTT CAACTGCTCC
TAAGCTGGAT CCCTGCAATC TTCTAAAGAT GGATTGATTT TCTGATGTTT CCCCATGAGT CCATGACATG AAACATTTTA
CACTTTCCTT GAGTTTTAGA AGGATTTACC TTTGTGCTTG CTGAACTAGC ATGCGGCACA ATTTTCTTGT TTCGTTTCTT
CAGGGCAATT CTTGGAGTGG AAGCCCTGCT CTCAGTGTTA AGATTCGTGA GTGTATGTAA ATATGAGGAA ATTTTCCTGT
GT