Os01t0834400-01

Locus

Os01g0834400

Description

Similar to HAP3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP3A

CGSNL Gene Name

HAP3A SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3A, OsNF-YB-2, NFYB2, NF-YB2

Oryzabase Gene Name Synonym(s)

rice HAP3A, Nuclear transcription factor Y subunit B-2, NUCLEAR FACTOR-Y subunit B2, NUCLEAR FACTOR-Y subunit NF-YB2, Transcriptional activator HAP3A, NF-YB subunit 2, NF-YB family 2

Transcript Evidence

AK108142 (DDBJ, Best hit)

Protein Evidence

Q5QMG3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Transcription factor, CBFA/NFYB, DNA topoisomerase (IPR003957)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

002-139-E10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0834400-01)

RiceXPro (AK108142)

Others

Oryzabase (3123)

KEGG (Os01t0834400-01)

Transcript

1082 bp

>Os01t0834400-01 Similar to HAP3.
aaccgccgtctcctcctccccccactctcgccttcccccctctctctcctctcctctccg
cgactccctccacccccgcgcgcgcgcgtTTTTTTTTTTTCGTAAGGGTTTTTGGAGGGC
GGCGCGGGGATGGCGGACGCGGGGCACGACGAGAGCGGGAGCCCGCCGAGGAGCGGCGGG
GTGAGGGAGCAGGACAGGTTCCTGCCCATCGCCAACATCAGCCGCATCATGAAGAAGGCC
GTCCCGGCGAACGGCAAGATCGCCAAGGACGCCAAGGAGACCCTGCAGGAGTGCGTCTCG
GAGTTCATCTCCTTCGTCACCAGCGAGGCGAGCGACAAATGTCAGAAGGAGAAGCGCAAG
ACCATCAACGGGGAAGATCTCCTCTTTGCGATGGGTACGCTTGGCTTTGAGGAGTACGTT
GATCCGTTGAAGATCTATTTACACAAGTACAGAGAGGTGTAGGGTGATAGTAAGCTGTCC
TCAAAGGCTGGTGATGGTTCAGTAAAGAAGGATACAATTGGTCCGCACAGTGGCGCTAGT
AGCTCAAGTGCGCAAGGGATGGTTGGGGCTTACACCCAAGGGATGGGTTATATGCAACCT
CAGTATCATAATGGGGACACCTAAAGATGAGGACAGTGAAAATTTTCAGTAACTGGTGTC
CTCTGTGAGTTATTATCCATCTGTTAAGGAAGAACCCACATTAGGGCCATATTTATTAGT
AGAAGACTAAAGCACTTGAAGGGTGTTGGTTTAGAAAGGGTGTTAACAGTTGGCTGTGGC
GATTGCTTCACAGATGTAAATTGCTTCATAAGTGGTTTAATGCTTGTTTTTGCCTGTATA
TTCAGAGCAATTTTCACATATTGGTAGTTCTGCAATCTTTTGCATTCCCATACATGTATC
AGGTGGCACAAATCTATTGCAAGTACCCTAGCATTGAATAATGCTGGTTAACATATAATT
CTGTAACGTCCGTATTGTTTCGACTGTGATGCTTGCCGTATGGGCAATGGCATGTGTTCT
AGAGGGGGCATTCAATATTTAGGTATCTCAAGAATGTACCAAATACTCCCTTCGTTCAAT
TC

CDS

357 bp

>Os01t0834400-01 Similar to HAP3.
GGGTTTTTGGAGGGCGGCGCGGGGATGGCGGACGCGGGGCACGACGAGAGCGGGAGCCCG
CCGAGGAGCGGCGGGGTGAGGGAGCAGGACAGGTTCCTGCCCATCGCCAACATCAGCCGC
ATCATGAAGAAGGCCGTCCCGGCGAACGGCAAGATCGCCAAGGACGCCAAGGAGACCCTG
CAGGAGTGCGTCTCGGAGTTCATCTCCTTCGTCACCAGCGAGGCGAGCGACAAATGTCAG
AAGGAGAAGCGCAAGACCATCAACGGGGAAGATCTCCTCTTTGCGATGGGTACGCTTGGC
TTTGAGGAGTACGTTGATCCGTTGAAGATCTATTTACACAAGTACAGAGAGGTGTAG

Protein

119 aa

>Os01t0834400-01 Similar to HAP3.
GFLEGGAGMADAGHDESGSPPRSGGVREQDRFLPIANISRIMKKAVPANGKIAKDAKETL
QECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHKYREV*

5'UTR

chr01:35758559..35758663 (- strand) : 105 bp

CDS

chr01:35758558..35758558 (- strand) : 1 bp

chr01:35758251..35758470 (- strand) : 220 bp

chr01:35757998..35758129 (- strand) : 132 bp

chr01:35757421..35757424 (- strand) : 4 bp

3'UTR

chr01:35757325..35757420 (- strand) : 96 bp

chr01:35757206..35757250 (- strand) : 45 bp

chr01:35757003..35757068 (- strand) : 66 bp

chr01:35756352..35756764 (- strand) : 413 bp

FASTA

>Os01t0834400-01 class=Sequence position=chr01:35756352..35758663 (- strand)
aaccgccgtc tcctcctccc cccactctcg ccttcccccc tctctctcct ctcctctccg cgactccctc cacccccgcg
cgcgcgcgtT TTTTTTTTTT CGTAAGGTAC GGATCCAACG ACGCTGCTCG GCTGCTCCTC TCCCCACCAC CATCTCTGAT
GGTTTGTTGC TGTGATGATG ATGATGGATC TAGGGTTTTT GGAGGGCGGC GCGGGGATGG CGGACGCGGG GCACGACGAG
AGCGGGAGCC CGCCGAGGAG CGGCGGGGTG AGGGAGCAGG ACAGGTTCCT GCCCATCGCC AACATCAGCC GCATCATGAA
GAAGGCCGTC CCGGCGAACG GCAAGATCGC CAAGGACGCC AAGGAGACCC TGCAGGAGTG CGTCTCGGAG TTCATCTCCT
TCGTCACCAG CGAGTGAGTC TGCGCGGGCT CGGTACCGTG ATCCTGCCCT CCCCACACCT TCTTTTGTGA TGGTTGGTTT
AGGGTGTGAT TTTGCTTTGC TTTGTGGTTT GGGCGGTGGT GCGGGATGGG ACAGGGCGAG CGACAAATGT CAGAAGGAGA
AGCGCAAGAC CATCAACGGG GAAGATCTCC TCTTTGCGAT GGGTACGCTT GGCTTTGAGG AGTACGTTGA TCCGTTGAAG
ATCTATTTAC ACAAGTACAG AGAGGTAATT GTGCGCTTCG TACTCTCTGC CAGTATAAAT GTTAAACCTT TCGTTGTTGT
ATGAATATCT GATGTCTCTT CTGTCCTCCT GGCAAATTTG CAATACGTGG GGATGTGCAC TGTTAACTGC AGATGGAGGT
ACACCATCTA CCATTCTACC CTCCTCAAAA TCCCCTTTTT TCCCCAACAA TATGCTATGG TTTCATGTGA ATTTTTTTTT
TGTCAACGCA AAAATGTGTC ACTCTTGTAA TCCTGCTTTT AGAACAATCC CACAAAAAAT TGATATGCAA TTATGCCCTT
TGATTAGAGA TAGTTGGTGC TCAACATGAA ATGTACATAT CCTACTCTGA ACTGTAAGGT TAACACCTGA ATCATTCTTT
CATTCCTCTG CTTCATATAC ATTGAAGGAA AGCTAACCGC ATCCATTTAG TATGTCACTG TTCAATTTGC CTGGAAATAT
ATATTTGTGC CTTAGTAATA CTCTAAGATC TATATTTGTG CCTTAGTAAA AGATCTATTT TTGTGCATCA AGATTCAAGA
TGTATTGAGT TCTAACCATA CCACTATTCC TTATTCTTGG TAGGGTGATA GTAAGCTGTC CTCAAAGGCT GGTGATGGTT
CAGTAAAGAA GGATACAATT GGTCCGCACA GTGGCGCTAG TAGCTCAAGT GCGCAAGGGG TTGGTATCAG TAACTTGTAC
TGCTTTGTTC TTTCTGATGT TTGAAAACAC TGACATACTG ATAATATTTT TAGATGGTTG GGGCTTACAC CCAAGGGATG
GGTTATATGC AACCTCAGGT AACCTAGCAC TAGCATAGTA TCATTTGTCA GCACAATGCT ATGGTTCATC CTTGAAGCTA
AACAAGATAT AAAGTAATAA TGCACATTCA ACTTTTTTTT TCTAGCTGAC ACTGTTTATG CCATTACACG TGCAGTATCA
TAATGGGGAC ACCTAAAGAT GAGGACAGTG AAAATTTTCA GTAACTGGTG TCCTCTGTGA GGTAAGATCT TTTGTACAGA
AATCATTTGC CATCCTTGGG GCAGTTTTCA GTTAGATGTT TTTTTCACTA AAAATTGCCC GTTCTGTCTC AAGGTTCACA
TATACTACAT CTGTATTTTT TTATTCTTTT TACATGTGAA CTCTGGAGAT GTTGAGCTGC ACATGTGAAA AATTCTCCGA
GTGCTTTTAT ACTTTTTCGC GCTCTTCTAG TTCTGACACA ATACTCCCTT TTGCTGCAGT TATTATCCAT CTGTTAAGGA
AGAACCCACA TTAGGGCCAT ATTTATTAGT AGAAGACTAA AGCACTTGAA GGGTGTTGGT TTAGAAAGGG TGTTAACAGT
TGGCTGTGGC GATTGCTTCA CAGATGTAAA TTGCTTCATA AGTGGTTTAA TGCTTGTTTT TGCCTGTATA TTCAGAGCAA
TTTTCACATA TTGGTAGTTC TGCAATCTTT TGCATTCCCA TACATGTATC AGGTGGCACA AATCTATTGC AAGTACCCTA
GCATTGAATA ATGCTGGTTA ACATATAATT CTGTAACGTC CGTATTGTTT CGACTGTGAT GCTTGCCGTA TGGGCAATGG
CATGTGTTCT AGAGGGGGCA TTCAATATTT AGGTATCTCA AGAATGTACC AAATACTCCC TTCGTTCAAT TC