Os01t0834400-02

Locus

Os01g0834400

Description

CCAAT-box binding transcription factor, Chloroplast biogenesis

RAP-DB Gene Symbol Synonym(s)

HAP3A, OsHAP3A,OsNF-YB-2, NFYB2

RAP-DB Gene Name Synonym(s)

HAP3A SUBUNIT OF CCAAT-BOX BINDING COMPLEX, rice HAP3A, Nuclear transcription factor Y subunit B-2, Transcriptional activator HAP3A

CGSNL Gene Symbol

HAP3A

CGSNL Gene Name

HAP3A SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3A, OsNF-YB-2, NFYB2, NF-YB2

Oryzabase Gene Name Synonym(s)

rice HAP3A, Nuclear transcription factor Y subunit B-2, NUCLEAR FACTOR-Y subunit B2, NUCLEAR FACTOR-Y subunit NF-YB2, Transcriptional activator HAP3A, NF-YB subunit 2, NF-YB family 2

Transcript Evidence

AB095438

Protein Evidence

Q5QMG3

Literature

PMID: 14617083

PMID: 18193457

Note

Manual Curation

December 24, 2009

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Molecular Function: protein heterodimerization activity (GO:0046982)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Histone-fold (IPR009072)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Others

Oryzabase (3123)

Transcript

945 bp

>Os01t0834400-02 CCAAT-box binding transcription factor, Chloroplast biogenesis
ATCCAACGACGCTGCTCGGCTGCTCCTCTCCCCACCACCATCTCTGATGGTTTGTTGCTG
TGATGATGATGATGGATCTAGGGTTTTTGGAGGGCGGCGCGGGGATGGCGGACGCGGGGC
ACGACGAGAGCGGGAGCCCGCCGAGGAGCGGCGGGGTGAGGGAGCAGGACAGGTTCCTGC
CCATCGCCAACATCAGCCGCATCATGAAGAAGGCCGTCCCGGCGAACGGCAAGATCGCCA
AGGACGCCAAGGAGACCCTGCAGGAGTGCGTCTCGGAGTTCATCTCCTTCGTCACCAGCG
AGGCGAGCGACAAATGTCAGAAGGAGAAGCGCAAGACCATCAACGGGGAAGATCTCCTCT
TTGCGATGGGTACGCTTGGCTTTGAGGAGTACGTTGATCCGTTGAAGATCTATTTACACA
AGTACAGAGAGATGGAGGGTGATAGTAAGCTGTCCTCAAAGGCTGGTGATGGTTCAGTAA
AGAAGGATACAATTGGTCCGCACAGTGGCGCTAGTAGCTCAAGTGCGCAAGGGATGGTTG
GGGCTTACACCCAAGGGATGGGTTATATGCAACCTCAGTATCATAATGGGGACACCTAAA
GATGAGGACAGTGAAAATTTTCAGTAACTGGTGTCCTCTGTGAGTTATTATCCATCTGTT
AAGGAAGAACCCACATTAGGGCCATATTTATTAGTAGAAGACTAAAGCACTTGAAGGGTG
TTGGTTTAGAAAGGGTGTTAACAGTTGGCTGTGGCGATTGCTTCACAGATGTAAATTGCT
TCATAAGTGGTTTAATGCTTGTTTTTGCCTGTATATTCAGAGCAATTTTCACATATTGGT
AGTTCTGCAATCTTTTGCATTCCCATACATGTATCAGGTGGCACAAATCTATTGCAAGTA
CCCTAGCATTGAATAATGCTGGTTAACATATAATTCTGTAACGTC

CDS

537 bp

>Os01t0834400-02 CCAAT-box binding transcription factor, Chloroplast biogenesis
ATGATGATGATGGATCTAGGGTTTTTGGAGGGCGGCGCGGGGATGGCGGACGCGGGGCAC
GACGAGAGCGGGAGCCCGCCGAGGAGCGGCGGGGTGAGGGAGCAGGACAGGTTCCTGCCC
ATCGCCAACATCAGCCGCATCATGAAGAAGGCCGTCCCGGCGAACGGCAAGATCGCCAAG
GACGCCAAGGAGACCCTGCAGGAGTGCGTCTCGGAGTTCATCTCCTTCGTCACCAGCGAG
GCGAGCGACAAATGTCAGAAGGAGAAGCGCAAGACCATCAACGGGGAAGATCTCCTCTTT
GCGATGGGTACGCTTGGCTTTGAGGAGTACGTTGATCCGTTGAAGATCTATTTACACAAG
TACAGAGAGATGGAGGGTGATAGTAAGCTGTCCTCAAAGGCTGGTGATGGTTCAGTAAAG
AAGGATACAATTGGTCCGCACAGTGGCGCTAGTAGCTCAAGTGCGCAAGGGATGGTTGGG
GCTTACACCCAAGGGATGGGTTATATGCAACCTCAGTATCATAATGGGGACACCTAA

Protein

179 aa

>Os01t0834400-02 CCAAT-box binding transcription factor, Chloroplast biogenesis
MMMMDLGFLEGGAGMADAGHDESGSPPRSGGVREQDRFLPIANISRIMKKAVPANGKIAK
DAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHK
YREMEGDSKLSSKAGDGSVKKDTIGPHSGASSSSAQGMVGAYTQGMGYMQPQYHNGDT*

5'UTR

chr01:35758490..35758551 (- strand) : 62 bp

CDS

chr01:35758251..35758489 (- strand) : 239 bp

chr01:35758000..35758129 (- strand) : 130 bp

chr01:35757866..35757871 (- strand) : 6 bp

chr01:35757325..35757420 (- strand) : 96 bp

chr01:35757206..35757250 (- strand) : 45 bp

chr01:35757048..35757068 (- strand) : 21 bp

3'UTR

chr01:35757003..35757047 (- strand) : 45 bp

chr01:35756464..35756764 (- strand) : 301 bp

FASTA

>Os01t0834400-02 class=Sequence position=chr01:35756464..35758551 (- strand)
ATCCAACGAC GCTGCTCGGC TGCTCCTCTC CCCACCACCA TCTCTGATGG TTTGTTGCTG TGATGATGAT GATGGATCTA
GGGTTTTTGG AGGGCGGCGC GGGGATGGCG GACGCGGGGC ACGACGAGAG CGGGAGCCCG CCGAGGAGCG GCGGGGTGAG
GGAGCAGGAC AGGTTCCTGC CCATCGCCAA CATCAGCCGC ATCATGAAGA AGGCCGTCCC GGCGAACGGC AAGATCGCCA
AGGACGCCAA GGAGACCCTG CAGGAGTGCG TCTCGGAGTT CATCTCCTTC GTCACCAGCG AGTGAGTCTG CGCGGGCTCG
GTACCGTGAT CCTGCCCTCC CCACACCTTC TTTTGTGATG GTTGGTTTAG GGTGTGATTT TGCTTTGCTT TGTGGTTTGG
GCGGTGGTGC GGGATGGGAC AGGGCGAGCG ACAAATGTCA GAAGGAGAAG CGCAAGACCA TCAACGGGGA AGATCTCCTC
TTTGCGATGG GTACGCTTGG CTTTGAGGAG TACGTTGATC CGTTGAAGAT CTATTTACAC AAGTACAGAG AGGTAATTGT
GCGCTTCGTA CTCTCTGCCA GTATAAATGT TAAACCTTTC GTTGTTGTAT GAATATCTGA TGTCTCTTCT GTCCTCCTGG
CAAATTTGCA ATACGTGGGG ATGTGCACTG TTAACTGCAG ATGGAGGTAC ACCATCTACC ATTCTACCCT CCTCAAAATC
CCCTTTTTTC CCCAACAATA TGCTATGGTT TCATGTGAAT TTTTTTTTTG TCAACGCAAA AATGTGTCAC TCTTGTAATC
CTGCTTTTAG AACAATCCCA CAAAAAATTG ATATGCAATT ATGCCCTTTG ATTAGAGATA GTTGGTGCTC AACATGAAAT
GTACATATCC TACTCTGAAC TGTAAGGTTA ACACCTGAAT CATTCTTTCA TTCCTCTGCT TCATATACAT TGAAGGAAAG
CTAACCGCAT CCATTTAGTA TGTCACTGTT CAATTTGCCT GGAAATATAT ATTTGTGCCT TAGTAATACT CTAAGATCTA
TATTTGTGCC TTAGTAAAAG ATCTATTTTT GTGCATCAAG ATTCAAGATG TATTGAGTTC TAACCATACC ACTATTCCTT
ATTCTTGGTA GGGTGATAGT AAGCTGTCCT CAAAGGCTGG TGATGGTTCA GTAAAGAAGG ATACAATTGG TCCGCACAGT
GGCGCTAGTA GCTCAAGTGC GCAAGGGGTT GGTATCAGTA ACTTGTACTG CTTTGTTCTT TCTGATGTTT GAAAACACTG
ACATACTGAT AATATTTTTA GATGGTTGGG GCTTACACCC AAGGGATGGG TTATATGCAA CCTCAGGTAA CCTAGCACTA
GCATAGTATC ATTTGTCAGC ACAATGCTAT GGTTCATCCT TGAAGCTAAA CAAGATATAA AGTAATAATG CACATTCAAC
TTTTTTTTTC TAGCTGACAC TGTTTATGCC ATTACACGTG CAGTATCATA ATGGGGACAC CTAAAGATGA GGACAGTGAA
AATTTTCAGT AACTGGTGTC CTCTGTGAGG TAAGATCTTT TGTACAGAAA TCATTTGCCA TCCTTGGGGC AGTTTTCAGT
TAGATGTTTT TTTCACTAAA AATTGCCCGT TCTGTCTCAA GGTTCACATA TACTACATCT GTATTTTTTT ATTCTTTTTA
CATGTGAACT CTGGAGATGT TGAGCTGCAC ATGTGAAAAA TTCTCCGAGT GCTTTTATAC TTTTTCGCGC TCTTCTAGTT
CTGACACAAT ACTCCCTTTT GCTGCAGTTA TTATCCATCT GTTAAGGAAG AACCCACATT AGGGCCATAT TTATTAGTAG
AAGACTAAAG CACTTGAAGG GTGTTGGTTT AGAAAGGGTG TTAACAGTTG GCTGTGGCGA TTGCTTCACA GATGTAAATT
GCTTCATAAG TGGTTTAATG CTTGTTTTTG CCTGTATATT CAGAGCAATT TTCACATATT GGTAGTTCTG CAATCTTTTG
CATTCCCATA CATGTATCAG GTGGCACAAA TCTATTGCAA GTACCCTAGC ATTGAATAAT GCTGGTTAAC ATATAATTCT
GTAACGTC