Os01t0835700-01

Locus

Os01g0835700

Description

CCT domain containing protein, Regulation of heading date

RAP-DB Gene Symbol Synonym(s)

OsCCT01

RAP-DB Gene Name Synonym(s)

CCT domain-containing gene 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCCT01, OsCMF1

Oryzabase Gene Name Synonym(s)

CCT domain-containing gene 1, CCT (CO, CO-LIKE and TOC1) domain protein 1, CCT domain protein 1, CCT MOTIF FAMILY (CMF) gene 1

Transcript Evidence

AK109941

Protein Evidence

Q5QMF4

Literature

PMID: 25563494

Note

Manual Curation

January 28, 2021

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

CCT domain (IPR010402)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

002-154-E04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0835700-01)

RiceXPro (AK109941)

Others

Oryzabase (19168)

KEGG (Os01t0835700-01)

Transcript

1363 bp

>Os01t0835700-01 CCT domain containing protein, Regulation of heading date
ACACAATTCGCCCGAAGTCCCAAGGCTTTTTTTACGTCCAAATTAAAAAGAAGCCATGTT
CCGCCATTCCTCCTCTGCCTCGTCGGCGGCCTCCTACGGCAGCGACGTCAGCTTCATGAA
CCACTCGCCGGCGGCCGCCTTGCCCGCCGTCCCGACGCAGATCCCTCGCGTCGCCGGCGG
CTACCTCGACGGCAATGTTAGCGGCGGGTTACCTCACTTCGGAGGGGCGGTGTCGTCGTC
GTCGTCGTCGCCGCCGTCCTACTCCTCGTCGCTCCCTTCGTCCTACTACAACAACATCCA
GAGGAGCATCAGCTCGCACTCCCTCCCGCATCACCTCCAGCTCACCGACCACTTCGGCGG
CGCATTCTTCTCGTCGTCGTCCTCCTCCTCCCACCAGCTGCCTCTGCCGCCGCCGCTCTC
CTCCTCGCCGTCCTCCTCCTCTGGCGACCTCTTCGAGTTCACCTCGCCATGCCCCGTCCG
CCGCGTCTTCAGCACCGGCGACCTCCAGGGGATGAACGGATCGTCGCCGCCGCGGCCGCT
CCCGTCCGGCGAAAGCTGCGGGCAAGACGGCAGCGGGCCATTCTCACAGAAGGTCGGGCG
GTACAGTGCCGAGGAGAGGAAGGAGAGGATCGAGAGGTATCGCGTGAAGCGGCATCAACG
CAACTTCAACAAGAAGATCACTTACGCGTGCAGGAAGACGCTGGCGGATAGCCGGCCGAG
GGTGAAAGGCCGGTTCGCGAGGAACGGCGAGGCCGACGCGGAGGGCGACGAGCGGGAGGC
GTTCGACGCGAGCTACAGCTACGACTACTCCGCCGCGGGCTACAGCGACTACCGCAGCGG
CAGCAACAGCAGCAGCGTCAACAGCTGCTACAATTACAACCGCAAGGACGGCGCCGCGAC
GGAAGCGTCTGTCGTCGGCGGCAGCGACAATGGCGAGTGGTGGTGGCGCGCGCCGGGCGC
CACCACCGCCGAGGCGGAGCGGCAGCGGCAGGCCGGCTTCGACGTCGACGAGGAGATATG
GGCCACCCTCGGCGACATGCTGTCCGTGAACCTCGCCTCGTAGTACGCTGTCGCCGCCGA
TCAGGGGAGCGAACGATCGAGCTGGAGATCTACCGGCGCGTAGGCCGGCGTCGTTGTTGG
TGGTCGGTGGGGTCCGGTGTTCGAGCACGAGCACGCACTAGCTAGCTCAGGGTGGCGGGC
GCGCGCGGGCGGGCGACCGGTGCGCAGCGTAGTGGTGCGCCAGCGCCAGTGTGCAGCGCG
CGAGAGGAGGAGGTCAGGTCAGGTCAGAGTGGCGTCGTTGACCTTCCCTTGTGTGTAGTA
TTATTGTAACTTTCGCCAGAAACATCATGAAAGCTGGGAAACG

CDS

1008 bp

>Os01t0835700-01 CCT domain containing protein, Regulation of heading date
ATGTTCCGCCATTCCTCCTCTGCCTCGTCGGCGGCCTCCTACGGCAGCGACGTCAGCTTC
ATGAACCACTCGCCGGCGGCCGCCTTGCCCGCCGTCCCGACGCAGATCCCTCGCGTCGCC
GGCGGCTACCTCGACGGCAATGTTAGCGGCGGGTTACCTCACTTCGGAGGGGCGGTGTCG
TCGTCGTCGTCGTCGCCGCCGTCCTACTCCTCGTCGCTCCCTTCGTCCTACTACAACAAC
ATCCAGAGGAGCATCAGCTCGCACTCCCTCCCGCATCACCTCCAGCTCACCGACCACTTC
GGCGGCGCATTCTTCTCGTCGTCGTCCTCCTCCTCCCACCAGCTGCCTCTGCCGCCGCCG
CTCTCCTCCTCGCCGTCCTCCTCCTCTGGCGACCTCTTCGAGTTCACCTCGCCATGCCCC
GTCCGCCGCGTCTTCAGCACCGGCGACCTCCAGGGGATGAACGGATCGTCGCCGCCGCGG
CCGCTCCCGTCCGGCGAAAGCTGCGGGCAAGACGGCAGCGGGCCATTCTCACAGAAGGTC
GGGCGGTACAGTGCCGAGGAGAGGAAGGAGAGGATCGAGAGGTATCGCGTGAAGCGGCAT
CAACGCAACTTCAACAAGAAGATCACTTACGCGTGCAGGAAGACGCTGGCGGATAGCCGG
CCGAGGGTGAAAGGCCGGTTCGCGAGGAACGGCGAGGCCGACGCGGAGGGCGACGAGCGG
GAGGCGTTCGACGCGAGCTACAGCTACGACTACTCCGCCGCGGGCTACAGCGACTACCGC
AGCGGCAGCAACAGCAGCAGCGTCAACAGCTGCTACAATTACAACCGCAAGGACGGCGCC
GCGACGGAAGCGTCTGTCGTCGGCGGCAGCGACAATGGCGAGTGGTGGTGGCGCGCGCCG
GGCGCCACCACCGCCGAGGCGGAGCGGCAGCGGCAGGCCGGCTTCGACGTCGACGAGGAG
ATATGGGCCACCCTCGGCGACATGCTGTCCGTGAACCTCGCCTCGTAG

Protein

336 aa

>Os01t0835700-01 CCT domain containing protein, Regulation of heading date
MFRHSSSASSAASYGSDVSFMNHSPAAALPAVPTQIPRVAGGYLDGNVSGGLPHFGGAVS
SSSSSPPSYSSSLPSSYYNNIQRSISSHSLPHHLQLTDHFGGAFFSSSSSSSHQLPLPPP
LSSSPSSSSGDLFEFTSPCPVRRVFSTGDLQGMNGSSPPRPLPSGESCGQDGSGPFSQKV
GRYSAEERKERIERYRVKRHQRNFNKKITYACRKTLADSRPRVKGRFARNGEADAEGDER
EAFDASYSYDYSAAGYSDYRSGSNSSSVNSCYNYNRKDGAATEASVVGGSDNGEWWWRAP
GATTAEAERQRQAGFDVDEEIWATLGDMLSVNLAS*

5'UTR

chr01:35828718..35828772 (- strand) : 55 bp

CDS

chr01:35828265..35828717 (- strand) : 453 bp

chr01:35827988..35828161 (- strand) : 174 bp

chr01:35827522..35827902 (- strand) : 381 bp

3'UTR

chr01:35827222..35827521 (- strand) : 300 bp

FASTA

>Os01t0835700-01 class=Sequence position=chr01:35827222..35828772 (- strand)
ACACAATTCG CCCGAAGTCC CAAGGCTTTT TTTACGTCCA AATTAAAAAG AAGCCATGTT CCGCCATTCC TCCTCTGCCT
CGTCGGCGGC CTCCTACGGC AGCGACGTCA GCTTCATGAA CCACTCGCCG GCGGCCGCCT TGCCCGCCGT CCCGACGCAG
ATCCCTCGCG TCGCCGGCGG CTACCTCGAC GGCAATGTTA GCGGCGGGTT ACCTCACTTC GGAGGGGCGG TGTCGTCGTC
GTCGTCGTCG CCGCCGTCCT ACTCCTCGTC GCTCCCTTCG TCCTACTACA ACAACATCCA GAGGAGCATC AGCTCGCACT
CCCTCCCGCA TCACCTCCAG CTCACCGACC ACTTCGGCGG CGCATTCTTC TCGTCGTCGT CCTCCTCCTC CCACCAGCTG
CCTCTGCCGC CGCCGCTCTC CTCCTCGCCG TCCTCCTCCT CTGGCGACCT CTTCGAGTTC ACCTCGCCAT GCCCCGTCCG
CCGCGTCTTC AGCACCGGCG ACCTCCAGGT AATATAAGCT GCATGCAACA GCTTGAACTG CACGGTGCAC ACTTCCAATC
GAGCTGCGTT CATGGAAGCT CGACTGACGA ATTGTGTCCT GACGAAAACA GGGGATGAAC GGATCGTCGC CGCCGCGGCC
GCTCCCGTCC GGCGAAAGCT GCGGGCAAGA CGGCAGCGGG CCATTCTCAC AGAAGGTCGG GCGGTACAGT GCCGAGGAGA
GGAAGGAGAG GATCGAGAGG TATCGCGTGA AGCGGCATCA ACGCAACTTC AACAAGAAGA TCACTGTAAC CATTCCCCTC
CTCCACGCTC AAAAATTGCA CTCTGATCGC CCATTATTCG TGCTGACGCT TTGGTTGTGT TTGGGGGCAG TACGCGTGCA
GGAAGACGCT GGCGGATAGC CGGCCGAGGG TGAAAGGCCG GTTCGCGAGG AACGGCGAGG CCGACGCGGA GGGCGACGAG
CGGGAGGCGT TCGACGCGAG CTACAGCTAC GACTACTCCG CCGCGGGCTA CAGCGACTAC CGCAGCGGCA GCAACAGCAG
CAGCGTCAAC AGCTGCTACA ATTACAACCG CAAGGACGGC GCCGCGACGG AAGCGTCTGT CGTCGGCGGC AGCGACAATG
GCGAGTGGTG GTGGCGCGCG CCGGGCGCCA CCACCGCCGA GGCGGAGCGG CAGCGGCAGG CCGGCTTCGA CGTCGACGAG
GAGATATGGG CCACCCTCGG CGACATGCTG TCCGTGAACC TCGCCTCGTA GTACGCTGTC GCCGCCGATC AGGGGAGCGA
ACGATCGAGC TGGAGATCTA CCGGCGCGTA GGCCGGCGTC GTTGTTGGTG GTCGGTGGGG TCCGGTGTTC GAGCACGAGC
ACGCACTAGC TAGCTCAGGG TGGCGGGCGC GCGCGGGCGG GCGACCGGTG CGCAGCGTAG TGGTGCGCCA GCGCCAGTGT
GCAGCGCGCG AGAGGAGGAG GTCAGGTCAG GTCAGAGTGG CGTCGTTGAC CTTCCCTTGT GTGTAGTATT ATTGTAACTT
TCGCCAGAAA CATCATGAAA GCTGGGAAAC G

Locus: Os01g0835700

Loading...

Locus: Os01g0835700

Loading...