Os01t0836600-01

Locus

Os01g0836600

Description

ATP-binding cassette (ABC) transporter, Half-size ABC transporter of the G family, Pollen wall formation

RAP-DB Gene Symbol Synonym(s)

OsABCG3

RAP-DB Gene Name Synonym(s)

ATP-binding cassette protein subfamily G member 3

CGSNL Gene Symbol

ABCG3

CGSNL Gene Name

ABC TRANSPORTER G FAMILY MEMBER 3

Oryzabase Gene Symbol Synonym(s)

OsABCG3

Oryzabase Gene Name Synonym(s)

ATP-binding cassette protein subfamily G member 3, ABC transporter superfamily ABCG subgroup member 3

Transcript Evidence

AK067556

Protein Evidence

Q8S1S3

Literature

PMID: 30311098

PMID: 18299247

Note

Manual Curation

October 12, 2018

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

ABC transporter-like (IPR003439)

AAA+ ATPase domain (IPR003593)

ABC-2 type transporter (IPR013525)

ABC transporter, conserved site (IPR017871)

Full-length cDNA

J013111O15 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0836600-01)

RiceXPro (AK067556)

Others

Oryzabase (9705)

KEGG (Os01t0836600-01)

Transcript

2622 bp

>Os01t0836600-01 ATP-binding cassette (ABC) transporter, Half-size ABC transporter of the G family, Pollen wall formation
CGCCATCTGAACCACGCCACGCCGAATCGTCCGTCGTCCTAGATAGTGCTTCGCTAGCTG
TGGGTGTGCATGCCATGGCGCGCGCAGTGCACGACCGCCTCCCGTTCCTAGCCACGCCCC
CGCCGGCGCCGGCGAGGGGCAGGAACCCGCCGCTCGCTGAGATGCTCCGCCTCGTCGGCG
CTGCCACCGTCGACTCCGACGCCGCCGCCGCCGCCGCGGATGAGGAGGCCAACGCGCTGT
CGTTGCCACTGCCGCGCGGTGGTGTTACTCCTCCTCCGCCTGGCGGGCGGACCATCCAGT
TCAGGCTGGCGTTCACCAGCCTCACCTACAGCGTCCGCGCGGCGCGGCGGGCGAGGCCCG
GCGGCGGCGATGGCGGCGGCGGGTTTCGCCTGCCTCTGCAGAACCGGTGCGACCGCGTCA
CCGCGGCGGCGCCCGACGCGCACTCGTCCCGCGCGAGGGTGCTGCTGGACGGCATCACCG
GGGAGGCGAGGGAGGGCGAGATCCTGGCGGTGATGGGGGCCAGTGGCTCCGGCAAGTCCA
CGCTCATCGACGCGCTCGCCAACCGCATCTCCCGCGACGCGCTCAAGGGCTCCGTCACGC
TCAACGGCGAGCCGCTCACCGGCAACGTCATCAAGTCCATCTCCGCCTACGTCATGCAGG
ACGATCTGCTGTTCCCCATGCTCACCGTCGCCGAGACGCTCTCCTTcgccgccgagttcc
gcctcccgcgcgcgctgcccgccgccaagaagcgcacgcgcgtgctggagctcatagaac
agctcggcctccgcgcggcggcggacaccatcatcggcgacgaGGGCCACCGTGGAGTCT
CGGGAGGCGAGCGCCGGAGGGTCTCCATCGGCACCGACATCATCCATGACCCCATCCTCC
TGTTCCTCGACGAGCCCACGTCGGGGCTCGACTCCACCTCGGCGTTCATGGTCGTGCAGG
TGCTCCGCAACATCGCCGAGAGCGGCAGCATTGTCATCACTTCCATCCACCAGCCGAGCC
AGCGCATCCTCGGCCTTCTTGACCGCCTCATCCTCCTCTCCGGTGGACGCACCGTCTTCA
GTGGACCTCCCTCCGCCATCCCGGCCTACTTCGCCGAGTTCGGGTACCCGGTGCCCGACG
ACGAGAACCGCGCCGAGTTCGCGCTCGACCTGATCCGCGAGTTCGAGTCGTTGCCGGCGG
GAACCGGACAGCTCGTCAGCTTCAACAAGACGTGGCAGGTCATGCACGCGGCGAGGCACA
ACCCAAACGATGATCCGTGGGCGCCAACCATGTCGCTGAAGGAGGCCATCAGCGCGAGCA
TCTCGCGCGGGAAGCTGGTGTCCGGCTCGGACGTGGCCGGCGAGGCGGCGTCGATGCACA
CCTACGCGAACCCGTTCTGGGTGGAGATGAAGGTGCTGACGAAGCGGTCGGCGATCAACA
CGCGGCGCATGCCGGAGCTGTTCCTCATCAGGCTCGGCGCCGTGGTGATCACCGGCGCGA
TCCTCGCCACCGTGTTCTACAAGCTCGACCAGTCGCCCAAGGGCGCGCAGGAGCGGCTCG
GCTTCTTCGCCTTCGCCATGTCCACCATGTTCTACACCTGCGCCGACGCGCTCCCGGTGT
TCCTGCACGAGCGCTACATCTTCCTCCGGGAGaccgcctacggcgcgtaccgccgcacct
cctacgtgctctccaacgccatcgtctccttcccgccgctcgtcgtgctctccctcgcct
tcgccttcaccacattcttcgccgtcggcctcgccggcggcgtgtccgggttcgccttct
acaccctcgccatcctcgcctccttctgggccggcagcgggttcgtcacgttcctctccg
gcgtcataccgcacgtcatgatcggctacaccgtcgtcgtCGCCATCCTCGCCTACTTCC
TCCTCTTCAGCGGCTTCTTCATCAACCGGGACAGGATACCGGACTACTGGATATGGTTCC
ACTACCTCTCACTCGTCAAGTACCCGTTCGAGGGCGTGCTCCAGAACGAGTTCGGCCGCG
GCGGCGAGTGCTACGTCCGTGGCACGCAGATGTTCGACAACTCGCCGCTGGCCGTGCTGC
CGGACACGGTGAAGACGAGGGTGCTGGCGTCCATCGGCACGGCGCTCGGCGTCAAGATCG
GCCCCAACACCTGCGTGATGACCGGGCACAACGTGCTCCGGGAGGCGGCGGTGACGCAGC
TCGGCAAGTGGGAGTGCCTCCTCGTCACGGCGGCGTGGGGCTTCTTCTTCCGGCTGCTCT
TCTACTTCAGCCTCGTGCTCGGCAGCAAGAACAAGAGGAGGTGATCGAGCCGTACGGACG
AGGTTGCACGCGCGCGCGCGCATTTGCGCACGCGTTTGAACGTCCGGGGGCATTAAACGC
TTGGGGAGAAATAGAGAGAAAATGATGGCCTAGTTAATTTGAAGCTGTTTAATTTATGCA
ATTGTTAAGGCGGATATGATGTGATTTCAATTTGGACCCCTTTTTGTTTCCTGTGATTTG
TAGCTAAATAAGTGGCTTATAGTCCACTACACTTTTTTTTCTTCTTTTTCTCTTTGTAGT
CGCTGTGTTAAAGACTTATATATGAAATGATGAAGTGTTTTG

CDS

2250 bp

>Os01t0836600-01 ATP-binding cassette (ABC) transporter, Half-size ABC transporter of the G family, Pollen wall formation
ATGGCGCGCGCAGTGCACGACCGCCTCCCGTTCCTAGCCACGCCCCCGCCGGCGCCGGCG
AGGGGCAGGAACCCGCCGCTCGCTGAGATGCTCCGCCTCGTCGGCGCTGCCACCGTCGAC
TCCGACGCCGCCGCCGCCGCCGCGGATGAGGAGGCCAACGCGCTGTCGTTGCCACTGCCG
CGCGGTGGTGTTACTCCTCCTCCGCCTGGCGGGCGGACCATCCAGTTCAGGCTGGCGTTC
ACCAGCCTCACCTACAGCGTCCGCGCGGCGCGGCGGGCGAGGCCCGGCGGCGGCGATGGC
GGCGGCGGGTTTCGCCTGCCTCTGCAGAACCGGTGCGACCGCGTCACCGCGGCGGCGCCC
GACGCGCACTCGTCCCGCGCGAGGGTGCTGCTGGACGGCATCACCGGGGAGGCGAGGGAG
GGCGAGATCCTGGCGGTGATGGGGGCCAGTGGCTCCGGCAAGTCCACGCTCATCGACGCG
CTCGCCAACCGCATCTCCCGCGACGCGCTCAAGGGCTCCGTCACGCTCAACGGCGAGCCG
CTCACCGGCAACGTCATCAAGTCCATCTCCGCCTACGTCATGCAGGACGATCTGCTGTTC
CCCATGCTCACCGTCGCCGAGACGCTCTCCTTcgccgccgagttccgcctcccgcgcgcg
ctgcccgccgccaagaagcgcacgcgcgtgctggagctcatagaacagctcggcctccgc
gcggcggcggacaccatcatcggcgacgaGGGCCACCGTGGAGTCTCGGGAGGCGAGCGC
CGGAGGGTCTCCATCGGCACCGACATCATCCATGACCCCATCCTCCTGTTCCTCGACGAG
CCCACGTCGGGGCTCGACTCCACCTCGGCGTTCATGGTCGTGCAGGTGCTCCGCAACATC
GCCGAGAGCGGCAGCATTGTCATCACTTCCATCCACCAGCCGAGCCAGCGCATCCTCGGC
CTTCTTGACCGCCTCATCCTCCTCTCCGGTGGACGCACCGTCTTCAGTGGACCTCCCTCC
GCCATCCCGGCCTACTTCGCCGAGTTCGGGTACCCGGTGCCCGACGACGAGAACCGCGCC
GAGTTCGCGCTCGACCTGATCCGCGAGTTCGAGTCGTTGCCGGCGGGAACCGGACAGCTC
GTCAGCTTCAACAAGACGTGGCAGGTCATGCACGCGGCGAGGCACAACCCAAACGATGAT
CCGTGGGCGCCAACCATGTCGCTGAAGGAGGCCATCAGCGCGAGCATCTCGCGCGGGAAG
CTGGTGTCCGGCTCGGACGTGGCCGGCGAGGCGGCGTCGATGCACACCTACGCGAACCCG
TTCTGGGTGGAGATGAAGGTGCTGACGAAGCGGTCGGCGATCAACACGCGGCGCATGCCG
GAGCTGTTCCTCATCAGGCTCGGCGCCGTGGTGATCACCGGCGCGATCCTCGCCACCGTG
TTCTACAAGCTCGACCAGTCGCCCAAGGGCGCGCAGGAGCGGCTCGGCTTCTTCGCCTTC
GCCATGTCCACCATGTTCTACACCTGCGCCGACGCGCTCCCGGTGTTCCTGCACGAGCGC
TACATCTTCCTCCGGGAGaccgcctacggcgcgtaccgccgcacctcctacgtgctctcc
aacgccatcgtctccttcccgccgctcgtcgtgctctccctcgccttcgccttcaccaca
ttcttcgccgtcggcctcgccggcggcgtgtccgggttcgccttctacaccctcgccatc
ctcgcctccttctgggccggcagcgggttcgtcacgttcctctccggcgtcataccgcac
gtcatgatcggctacaccgtcgtcgtCGCCATCCTCGCCTACTTCCTCCTCTTCAGCGGC
TTCTTCATCAACCGGGACAGGATACCGGACTACTGGATATGGTTCCACTACCTCTCACTC
GTCAAGTACCCGTTCGAGGGCGTGCTCCAGAACGAGTTCGGCCGCGGCGGCGAGTGCTAC
GTCCGTGGCACGCAGATGTTCGACAACTCGCCGCTGGCCGTGCTGCCGGACACGGTGAAG
ACGAGGGTGCTGGCGTCCATCGGCACGGCGCTCGGCGTCAAGATCGGCCCCAACACCTGC
GTGATGACCGGGCACAACGTGCTCCGGGAGGCGGCGGTGACGCAGCTCGGCAAGTGGGAG
TGCCTCCTCGTCACGGCGGCGTGGGGCTTCTTCTTCCGGCTGCTCTTCTACTTCAGCCTC
GTGCTCGGCAGCAAGAACAAGAGGAGGTGA

Protein

750 aa

>Os01t0836600-01 ATP-binding cassette (ABC) transporter, Half-size ABC transporter of the G family, Pollen wall formation
MARAVHDRLPFLATPPPAPARGRNPPLAEMLRLVGAATVDSDAAAAAADEEANALSLPLP
RGGVTPPPPGGRTIQFRLAFTSLTYSVRAARRARPGGGDGGGGFRLPLQNRCDRVTAAAP
DAHSSRARVLLDGITGEAREGEILAVMGASGSGKSTLIDALANRISRDALKGSVTLNGEP
LTGNVIKSISAYVMQDDLLFPMLTVAETLSFAAEFRLPRALPAAKKRTRVLELIEQLGLR
AAADTIIGDEGHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAFMVVQVLRNI
AESGSIVITSIHQPSQRILGLLDRLILLSGGRTVFSGPPSAIPAYFAEFGYPVPDDENRA
EFALDLIREFESLPAGTGQLVSFNKTWQVMHAARHNPNDDPWAPTMSLKEAISASISRGK
LVSGSDVAGEAASMHTYANPFWVEMKVLTKRSAINTRRMPELFLIRLGAVVITGAILATV
FYKLDQSPKGAQERLGFFAFAMSTMFYTCADALPVFLHERYIFLRETAYGAYRRTSYVLS
NAIVSFPPLVVLSLAFAFTTFFAVGLAGGVSGFAFYTLAILASFWAGSGFVTFLSGVIPH
VMIGYTVVVAILAYFLLFSGFFINRDRIPDYWIWFHYLSLVKYPFEGVLQNEFGRGGECY
VRGTQMFDNSPLAVLPDTVKTRVLASIGTALGVKIGPNTCVMTGHNVLREAAVTQLGKWE
CLLVTAAWGFFFRLLFYFSLVLGSKNKRR*

5'UTR

chr01:35861267..35861340 (+ strand) : 74 bp

CDS

chr01:35861341..35863590 (+ strand) : 2250 bp

3'UTR

chr01:35863591..35863888 (+ strand) : 298 bp

FASTA

>Os01t0836600-01 class=Sequence position=chr01:35861267..35863888 (+ strand)
CGCCATCTGA ACCACGCCAC GCCGAATCGT CCGTCGTCCT AGATAGTGCT TCGCTAGCTG TGGGTGTGCA TGCCATGGCG
CGCGCAGTGC ACGACCGCCT CCCGTTCCTA GCCACGCCCC CGCCGGCGCC GGCGAGGGGC AGGAACCCGC CGCTCGCTGA
GATGCTCCGC CTCGTCGGCG CTGCCACCGT CGACTCCGAC GCCGCCGCCG CCGCCGCGGA TGAGGAGGCC AACGCGCTGT
CGTTGCCACT GCCGCGCGGT GGTGTTACTC CTCCTCCGCC TGGCGGGCGG ACCATCCAGT TCAGGCTGGC GTTCACCAGC
CTCACCTACA GCGTCCGCGC GGCGCGGCGG GCGAGGCCCG GCGGCGGCGA TGGCGGCGGC GGGTTTCGCC TGCCTCTGCA
GAACCGGTGC GACCGCGTCA CCGCGGCGGC GCCCGACGCG CACTCGTCCC GCGCGAGGGT GCTGCTGGAC GGCATCACCG
GGGAGGCGAG GGAGGGCGAG ATCCTGGCGG TGATGGGGGC CAGTGGCTCC GGCAAGTCCA CGCTCATCGA CGCGCTCGCC
AACCGCATCT CCCGCGACGC GCTCAAGGGC TCCGTCACGC TCAACGGCGA GCCGCTCACC GGCAACGTCA TCAAGTCCAT
CTCCGCCTAC GTCATGCAGG ACGATCTGCT GTTCCCCATG CTCACCGTCG CCGAGACGCT CTCCTTcgcc gccgagttcc
gcctcccgcg cgcgctgccc gccgccaaga agcgcacgcg cgtgctggag ctcatagaac agctcggcct ccgcgcggcg
gcggacacca tcatcggcga cgaGGGCCAC CGTGGAGTCT CGGGAGGCGA GCGCCGGAGG GTCTCCATCG GCACCGACAT
CATCCATGAC CCCATCCTCC TGTTCCTCGA CGAGCCCACG TCGGGGCTCG ACTCCACCTC GGCGTTCATG GTCGTGCAGG
TGCTCCGCAA CATCGCCGAG AGCGGCAGCA TTGTCATCAC TTCCATCCAC CAGCCGAGCC AGCGCATCCT CGGCCTTCTT
GACCGCCTCA TCCTCCTCTC CGGTGGACGC ACCGTCTTCA GTGGACCTCC CTCCGCCATC CCGGCCTACT TCGCCGAGTT
CGGGTACCCG GTGCCCGACG ACGAGAACCG CGCCGAGTTC GCGCTCGACC TGATCCGCGA GTTCGAGTCG TTGCCGGCGG
GAACCGGACA GCTCGTCAGC TTCAACAAGA CGTGGCAGGT CATGCACGCG GCGAGGCACA ACCCAAACGA TGATCCGTGG
GCGCCAACCA TGTCGCTGAA GGAGGCCATC AGCGCGAGCA TCTCGCGCGG GAAGCTGGTG TCCGGCTCGG ACGTGGCCGG
CGAGGCGGCG TCGATGCACA CCTACGCGAA CCCGTTCTGG GTGGAGATGA AGGTGCTGAC GAAGCGGTCG GCGATCAACA
CGCGGCGCAT GCCGGAGCTG TTCCTCATCA GGCTCGGCGC CGTGGTGATC ACCGGCGCGA TCCTCGCCAC CGTGTTCTAC
AAGCTCGACC AGTCGCCCAA GGGCGCGCAG GAGCGGCTCG GCTTCTTCGC CTTCGCCATG TCCACCATGT TCTACACCTG
CGCCGACGCG CTCCCGGTGT TCCTGCACGA GCGCTACATC TTCCTCCGGG AGaccgccta cggcgcgtac cgccgcacct
cctacgtgct ctccaacgcc atcgtctcct tcccgccgct cgtcgtgctc tccctcgcct tcgccttcac cacattcttc
gccgtcggcc tcgccggcgg cgtgtccggg ttcgccttct acaccctcgc catcctcgcc tccttctggg ccggcagcgg
gttcgtcacg ttcctctccg gcgtcatacc gcacgtcatg atcggctaca ccgtcgtcgt CGCCATCCTC GCCTACTTCC
TCCTCTTCAG CGGCTTCTTC ATCAACCGGG ACAGGATACC GGACTACTGG ATATGGTTCC ACTACCTCTC ACTCGTCAAG
TACCCGTTCG AGGGCGTGCT CCAGAACGAG TTCGGCCGCG GCGGCGAGTG CTACGTCCGT GGCACGCAGA TGTTCGACAA
CTCGCCGCTG GCCGTGCTGC CGGACACGGT GAAGACGAGG GTGCTGGCGT CCATCGGCAC GGCGCTCGGC GTCAAGATCG
GCCCCAACAC CTGCGTGATG ACCGGGCACA ACGTGCTCCG GGAGGCGGCG GTGACGCAGC TCGGCAAGTG GGAGTGCCTC
CTCGTCACGG CGGCGTGGGG CTTCTTCTTC CGGCTGCTCT TCTACTTCAG CCTCGTGCTC GGCAGCAAGA ACAAGAGGAG
GTGATCGAGC CGTACGGACG AGGTTGCACG CGCGCGCGCG CATTTGCGCA CGCGTTTGAA CGTCCGGGGG CATTAAACGC
TTGGGGAGAA ATAGAGAGAA AATGATGGCC TAGTTAATTT GAAGCTGTTT AATTTATGCA ATTGTTAAGG CGGATATGAT
GTGATTTCAA TTTGGACCCC TTTTTGTTTC CTGTGATTTG TAGCTAAATA AGTGGCTTAT AGTCCACTAC ACTTTTTTTT
CTTCTTTTTC TCTTTGTAGT CGCTGTGTTA AAGACTTATA TATGAAATGA TGAAGTGTTT TG