Os01t0837100-00

Locus

Os01g0837100

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPLL2, PLL2

Oryzabase Gene Name Synonym(s)

Pectate lyase-like 2

Transcript Evidence

BT018120 (DDBJ)

Protein Evidence

B6TJY9 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Pectate lyase/Amb allergen (IPR002022)

Pectin lyase fold/virulence factor (IPR011050)

Pectin lyase fold (IPR012334)

AmbAllergen (IPR018082)

Expression Databases

TENOR (Os01t0837100-00)

Others

Oryzabase (22487)

KEGG (Os01t0837100-00 (EC:4.2.2.2))

Transcript

1242 bp

>Os01t0837100-00 Similar to predicted protein.
GCAGCTCCCTTACCACCTCCAGGTGCCCCCTCTCCGCCGCGGCGACGAGCGGCGTCTCCC
CGGCCTCGTTGGGCTCCGCCGCCACGGCCCGCCGCACCTCCTCCAGCGCCTCCCTCCCCT
CCCCGGTGGCCACGGCCGCCGCCGCCTCGTCCAGCGCGCGGCGCAGCGCCCCGGCGTCCC
CTCCGCGGGCCGCCACGGAGTCGTGTTCATGCCGTACGCCACCGCGGACTCCTCGCTGCG
CGTCATGGCCGGTCAGGCCGAGGGCTTCGGCCGCCACGCCATCGGCGGCCTCCACGGCGA
CCAAATGGGTCTCGATCTCCAGACGACGgggacgggtcgctccgggagggttgccggagg
cgcgagccgctatggatcgtcttcgacgtgtcgggcaccatccacctctcgacgggactg
cgcgtgtcgtcgtacaagaccatcgacggccgcgggcagcgtgtgacactgtccggcaag
gggctccagctgcgggagtgcgagcatgtgatcgtctgcaacctggaggtggaagggtgc
cgcggccacgacgccgacgccgtggcggtgaagcccgggtcgcggcacgtgtggatcgac
cggtgcggcctccgcggctgcggcgacggcctcctcgacgtcacccggggcagcacggac
gtgaccgtgtccaggtgccgcttctcggcgcacgacAAGGCCGTGCTGATCGGCGGCAGC
GCCGGCCACGTCGAGGACCGTGCCATCCGGGTGACCATCCACCACTGCCTCTTCGACGGC
ACGCGGCAGAGGCACCCGCGCGTCCGCTTCGGCAGGGTGCACCTCTACAACAACTACACC
AGGGGCTGGGGCATTTACGCTGTCTGCGCCAGTGTCGAGTCACAGATTGTATCCCAGTGC
AACATTTACGAGGCAGGGGAGAAGAAGAAAGTCTTCAAGTACATGATAGAACAGGCGGCA
GACAGAGACCAGAGTTCAACTGGGTTCATCCGGTCTGAAGGCGACCTGTTCCTGAACGGT
GCAGAGGAGTGCACTGCTCAGGATTCAGAAGCTGCGGCAGATGAGCTGTGGGACTTCAAG
ATTCAGGAATTGGATTTCTACCAGTCTTGTTCCGTTCAGCCGGCGTCAATGGCGCTCAAG
GAGCTACTGGAGTGCTTCACCGGCTGGCAGCCAGTTCCGCTGCCGGAAGACACTTGCCTC
GAAGAGGAAACTGATTCTGCTCCTGCTGACACTACTGCTTGA

CDS

1242 bp

>Os01t0837100-00 Similar to predicted protein.
GCAGCTCCCTTACCACCTCCAGGTGCCCCCTCTCCGCCGCGGCGACGAGCGGCGTCTCCC
CGGCCTCGTTGGGCTCCGCCGCCACGGCCCGCCGCACCTCCTCCAGCGCCTCCCTCCCCT
CCCCGGTGGCCACGGCCGCCGCCGCCTCGTCCAGCGCGCGGCGCAGCGCCCCGGCGTCCC
CTCCGCGGGCCGCCACGGAGTCGTGTTCATGCCGTACGCCACCGCGGACTCCTCGCTGCG
CGTCATGGCCGGTCAGGCCGAGGGCTTCGGCCGCCACGCCATCGGCGGCCTCCACGGCGA
CCAAATGGGTCTCGATCTCCAGACGACGgggacgggtcgctccgggagggttgccggagg
cgcgagccgctatggatcgtcttcgacgtgtcgggcaccatccacctctcgacgggactg
cgcgtgtcgtcgtacaagaccatcgacggccgcgggcagcgtgtgacactgtccggcaag
gggctccagctgcgggagtgcgagcatgtgatcgtctgcaacctggaggtggaagggtgc
cgcggccacgacgccgacgccgtggcggtgaagcccgggtcgcggcacgtgtggatcgac
cggtgcggcctccgcggctgcggcgacggcctcctcgacgtcacccggggcagcacggac
gtgaccgtgtccaggtgccgcttctcggcgcacgacAAGGCCGTGCTGATCGGCGGCAGC
GCCGGCCACGTCGAGGACCGTGCCATCCGGGTGACCATCCACCACTGCCTCTTCGACGGC
ACGCGGCAGAGGCACCCGCGCGTCCGCTTCGGCAGGGTGCACCTCTACAACAACTACACC
AGGGGCTGGGGCATTTACGCTGTCTGCGCCAGTGTCGAGTCACAGATTGTATCCCAGTGC
AACATTTACGAGGCAGGGGAGAAGAAGAAAGTCTTCAAGTACATGATAGAACAGGCGGCA
GACAGAGACCAGAGTTCAACTGGGTTCATCCGGTCTGAAGGCGACCTGTTCCTGAACGGT
GCAGAGGAGTGCACTGCTCAGGATTCAGAAGCTGCGGCAGATGAGCTGTGGGACTTCAAG
ATTCAGGAATTGGATTTCTACCAGTCTTGTTCCGTTCAGCCGGCGTCAATGGCGCTCAAG
GAGCTACTGGAGTGCTTCACCGGCTGGCAGCCAGTTCCGCTGCCGGAAGACACTTGCCTC
GAAGAGGAAACTGATTCTGCTCCTGCTGACACTACTGCTTGA

Protein

413 aa

>Os01t0837100-00 Similar to predicted protein.
AAPLPPPGAPSPPRRRAASPRPRWAPPPRPAAPPPAPPSPPRWPRPPPPRPARGAAPRRP
LRGPPRSRVHAVRHRGLLAARHGRSGRGLRPPRHRRPPRRPNGSRSPDDGDGSLREGCRR
REPLWIVFDVSGTIHLSTGLRVSSYKTIDGRGQRVTLSGKGLQLRECEHVIVCNLEVEGC
RGHDADAVAVKPGSRHVWIDRCGLRGCGDGLLDVTRGSTDVTVSRCRFSAHDKAVLIGGS
AGHVEDRAIRVTIHHCLFDGTRQRHPRVRFGRVHLYNNYTRGWGIYAVCASVESQIVSQC
NIYEAGEKKKVFKYMIEQAADRDQSSTGFIRSEGDLFLNGAEECTAQDSEAAADELWDFK
IQELDFYQSCSVQPASMALKELLECFTGWQPVPLPEDTCLEEETDSAPADTTA*

CDS

chr01:35887937..35888132 (+ strand) : 196 bp

chr01:35889860..35889964 (+ strand) : 105 bp

chr01:35890051..35890634 (+ strand) : 584 bp

chr01:35890869..35890937 (+ strand) : 69 bp

chr01:35891078..35891365 (+ strand) : 288 bp

FASTA

>Os01t0837100-00 class=Sequence position=chr01:35887937..35891365 (+ strand)
GCAGCTCCCT TACCACCTCC AGGTGCCCCC TCTCCGCCGC GGCGACGAGC GGCGTCTCCC CGGCCTCGTT GGGCTCCGCC
GCCACGGCCC GCCGCACCTC CTCCAGCGCC TCCCTCCCCT CCCCGGTGGC CACGGCCGCC GCCGCCTCGT CCAGCGCGCG
GCGCAGCGCC CCGGCGTCCC CTCCGCGGGC CGCCACGTGC AGGTCGGTGT CGTTGTGCCG CCCCGTCACC TGCCGCACGT
ACCGCCCCCG CTTCCCGCTC CCCGACACCG TCATCACCTT CACCGCCGCC GCCGCCGCCG TACCTCCTCC CTCCTCTGCG
CCCAAACAAC CAAAAACAAA CCAAATCAGC GCCTCGAGCA CGCACACTCC ACCAAACCTG TCCAAACATT CCCATCACTC
ACCTTCATGG ATTTCGAGCG ACATCGCGAG CGAGATAAGC GAATGCAGTA GCCAGTAGTG GGATTATCCC TGGGTCAAAG
CCGCGCGGTA GGGTTCCCGA GGTAGGGTTT CGGGCGGGGA GCGGCTTTAA GAGGCGCACG GCCGGCGGCG AAAGAGGAAG
GCACGAGGAA AGAGAGGTGG GGGCGGAGGA GGAGGAGGAC AATGGCGAGA CGGTAACGAC TCCCTTTGGA TTGTAGCTTT
CGCGGAGGAG GTTTTGTTGG GGTTTGGGCC ATCAGCCGGG CGGGAGGTGG GGGGAAGAAA GCGAGGCGTG GGGCCCACTT
GTCAGAGACG CGAGCGGGAG TGAGAAGTTG CCCGGTGGCT TCGACGCCGT CCTTTTCCTC GTGGAACGTC GACGTCACGG
CGATGAGTCC AAGCGGAAGA AGAGATCGGA AGTGGGAGAG AATTGCGCTG TCGCGCGTCA CGTAAATCCA CGCACGGGGG
GATTATGGGC ACGTTCGGTT TTGGCTCTAT CGAGCGGAAA TTATACGTAA TCGACGACCC TTTTTTTGCT TAAACTAACG
CTGGTTATTG CGTACCTGCT GCGTGGTTAG TGATTGTACA TTCGTGTCCT GTGTGTGTAT CCACTGAGCC GGCAATGACA
CTTCGCAGAT AGCCAATACA GCTTCGATCG GAGACCATTC AGGATCTTCC TTTGAGAGTT TGAGTGGACT TTGTTCGGAC
GCAATCCGAT GCTGACATGA AAGGGAGCCC ATGAAACGGG CGAGAAAAAG ACGACCCGCA ACCGGCGGTA GGAATATGAG
GAAACGAGGG AAGGTTACGT GACAACGACA CACCAAACTT CGCACTGTCG GATGTCTCGC ACGATGATAT TACTTAAAAC
TTTCATCAAA CAGTACAAAA ATGGGAAGGG CCATGACCGA TTTTTTGCCT TTTTGGCCTA GAAGATTAGA GAGGGTTTTC
AGGCAAAGAG GATATTCCGA TGTGATGTTT TTAGCTAAGA TTGATCAAAG GGGGAGAGTT TCCCAACTGA TTTTTCATTC
AAGATTAGTC TCATGTGATG TTATGAACAT TAAACGATCT AACAGCGAAA ACTTATGTTA GGGACAAGCT TAAATGCACT
GACGTTTCCG GGCAATGGGA GGTAAAAACA TCACGATCGA GATTGAATGA TAGTTTGAAA TCGAATGCTC GTAACGTCAT
GCAGATAGTA ACGAGCTCGT GCTGGATGCA ATGCAACGAC CCTGCAAACT CCTAAAACGC TCTGTTTGAC CTGTGTTAAT
CCCTTCCGGA CTTCCGGTTG GCGGCTTGTC TGGGCCGGCC CGAAACGCGC GCGCCGCTGC AAAAGCGGAA ACGGGCCAAA
CGGCCCGGTC GCAACAAATT CCAGCAGTAA ACAGCACTAC AGCAGGCGTT TCCCCGCGCG CGACTCAACA AATAGCGACG
CGAAAACCTC CTCGTAGTCG GTAGCCATGG AGCCTCCTCA ACTCGACGGC CAGTGCGGGG GCGAGCCACC GGCATCCGTG
GAGGGAGTCG TGTTCATGCC GTACGCCACC GCGGACTCCT CGCTGCGCGT CATGGCCGGT CAGGCCGAGG GCTTCGGCCG
CCACGCCATC GGCGGCCTCC ACGGCGACGT CTACCACGTC ACGACCCTCG AGGGCACGTA CACTAACACA CACAAGCCTA
TTCATATTCC ATCTCCCTGC ATCTAACAAC GTAGCAAATG GGTCTCGATC TCCAGACGAC Ggggacgggt cgctccggga
gggttgccgg aggcgcgagc cgctatggat cgtcttcgac gtgtcgggca ccatccacct ctcgacggga ctgcgcgtgt
cgtcgtacaa gaccatcgac ggccgcgggc agcgtgtgac actgtccggc aaggggctcc agctgcggga gtgcgagcat
gtgatcgtct gcaacctgga ggtggaaggg tgccgcggcc acgacgccga cgccgtggcg gtgaagcccg ggtcgcggca
cgtgtggatc gaccggtgcg gcctccgcgg ctgcggcgac ggcctcctcg acgtcacccg gggcagcacg gacgtgaccg
tgtccaggtg ccgcttctcg gcgcacgacA AGGCCGTGCT GATCGGCGGC AGCGCCGGCC ACGTCGAGGA CCGTGCCATC
CGGGTGACCA TCCACCACTG CCTCTTCGAC GGCACGCGGC AGAGGCACCC GCGCGTCCGC TTCGGCAGGG TGCACCTCTA
CAACAACTAC ACCAGGGGCT GGGGCATTTA CGCTGTCTGC GCCAGTGTCG AGTCACAGGT AACTACTCCC TCCATCCCAA
AATCCCAACC TAGTATTAAA TAAGACGTTT TTTATACATA AGTATGTCTG ATTTGTTGTT TTAGAAAGTA TCACATCTAA
TACTAGATTG GTTTTTTTGG CCGGAGAGAG CACACCTGAA AAAAAAATCA GATCAAGCTG GAACTTCATT GTACGAGATT
TTTTTTTTCG GGGAATTGTA CGAATTTAAC CTGAAGTTGA TTACTGCTGC AGATTGTATC CCAGTGCAAC ATTTACGAGG
CAGGGGAGAA GAAGAAAGTC TTCAAGTACA TGATAGAACA GGTCATTTTC CTCGTTTCAG AACCCTGTAC TAGTTCAGTA
TCTTATCCTA AATTATGTTA CGCCACGTAA TGGTGGATAA AACGTTTTAA CTTAGATACT TCTAAAAATG CTTTGCATTG
GTGAAATGGT GATTGCAACA GGCGGCAGAC AGAGACCAGA GTTCAACTGG GTTCATCCGG TCTGAAGGCG ACCTGTTCCT
GAACGGTGCA GAGGAGTGCA CTGCTCAGGA TTCAGAAGCT GCGGCAGATG AGCTGTGGGA CTTCAAGATT CAGGAATTGG
ATTTCTACCA GTCTTGTTCC GTTCAGCCGG CGTCAATGGC GCTCAAGGAG CTACTGGAGT GCTTCACCGG CTGGCAGCCA
GTTCCGCTGC CGGAAGACAC TTGCCTCGAA GAGGAAACTG ATTCTGCTCC TGCTGACACT ACTGCTTGA

Locus: Os01g0837100

Loading...

Locus: Os01g0837100

Loading...