Os01t0838350-01

Locus

Os01g0838350

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PI1

CGSNL Gene Name

PHOSPHATE-LIMITATION INDUCIBLE GENE 1

Oryzabase Gene Symbol Synonym(s)

OsIPS2, IPS2, OsPI1

Oryzabase Gene Name Synonym(s)

Oryza sativa Phosphate-limitation Inducible Gene 1, induced by phosphate starvation 2, phosphate starvation 2

Transcript Evidence

AK240849 (DDBJ, Best hit)

Protein Evidence

NP_001172640.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

J065020F01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0838350-01)

Others

Oryzabase (9860)

KEGG (Os01t0838350-01)

Transcript

385 bp

>Os01t0838350-01 Conserved hypothetical protein.
GGAGGACCCTTCTTCTGGATTCCTCTCTACCCCCAACAATGGCCTGACACCGCTGCCCTG
CATGCAACCCATGCAGTGTTCTCACTACTTCTCAGCTTCGCCGGTGGTGTTGAAGATGAT
GCCTCAACGGCCGATGCAGCGAAGGTATCCACTAGGCAGGTGCTAGGCCATGTAGGGCAA
CTAAACAACTTTGGCAGGTCTTCCTTCTCCATCTCGACAAGAAGATGGTAATGGAGTGTC
TATATCCCCGGAGCTCTCTTGATAGAATTCATCATCATGTATCAGTTGTTCTATTACAAT
AGTAATAATCAGAACTAGTGCTCTTGTTGTGGAGACTACTGTATCTTTTGTGGTGAACTA
GTATTTGTCATGGCATCTTTTCTTG

CDS

165 bp

>Os01t0838350-01 Conserved hypothetical protein.
GAGGACCCTTCTTCTGGATTCCTCTCTACCCCCAACAATGGCCTGACACCGCTGCCCTGC
ATGCAACCCATGCAGTGTTCTCACTACTTCTCAGCTTCGCCGGTGGTGTTGAAGATGATG
CCTCAACGGCCGATGCAGCGAAGGTATCCACTAGGCAGGTGCTAG

Protein

55 aa

>Os01t0838350-01 Conserved hypothetical protein.
EDPSSGFLSTPNNGLTPLPCMQPMQCSHYFSASPVVLKMMPQRPMQRRYPLGRC*

5'UTR

chr01:35959019..35959019 (- strand) : 1 bp

CDS

chr01:35958854..35959018 (- strand) : 165 bp

3'UTR

chr01:35958635..35958853 (- strand) : 219 bp

FASTA

>Os01t0838350-01 class=Sequence position=chr01:35958635..35959019 (- strand)
GGAGGACCCT TCTTCTGGAT TCCTCTCTAC CCCCAACAAT GGCCTGACAC CGCTGCCCTG CATGCAACCC ATGCAGTGTT
CTCACTACTT CTCAGCTTCG CCGGTGGTGT TGAAGATGAT GCCTCAACGG CCGATGCAGC GAAGGTATCC ACTAGGCAGG
TGCTAGGCCA TGTAGGGCAA CTAAACAACT TTGGCAGGTC TTCCTTCTCC ATCTCGACAA GAAGATGGTA ATGGAGTGTC
TATATCCCCG GAGCTCTCTT GATAGAATTC ATCATCATGT ATCAGTTGTT CTATTACAAT AGTAATAATC AGAACTAGTG
CTCTTGTTGT GGAGACTACT GTATCTTTTG TGGTGAACTA GTATTTGTCA TGGCATCTTT TCTTG

Locus: Os01g0838350

Loading...

Locus: Os01g0838350

Loading...