Os01t0839200-01

Locus

Os01g0839200

Description

DUF966 family protein, Abiotic stress response

RAP-DB Gene Symbol Synonym(s)

OsDSR2

RAP-DB Gene Name Synonym(s)

DUF966-stress repressive gene 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDSR2

Oryzabase Gene Name Synonym(s)

DUF966-stress repressive gene 2

Transcript Evidence

AK068926

Protein Evidence

Q943L5

Literature

PMID: 24247850

Note

Manual Curation

January 16, 2017

Functional domain (InterPro)

Protein of unknown function DUF966 (IPR010369)

Uncharacterised conserved protein UCP031043 (IPR021182)

Full-length cDNA

J013170N02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0839200-01)

RiceXPro (AK068926)

Others

Oryzabase (15439)

KEGG (Os01t0839200-01)

Transcript

1400 bp

>Os01t0839200-01 DUF966 family protein, Abiotic stress response
AGCAGCAGCAGCCAGCAAGGGTAGGTTAGGTTGACGAGGATGGCAGTGGTGGTGGCTGGC
AGCAGGGGGAAAGGGGAGCAGCAGCGGCTGCCGTGGCGAGAGGCGCAGCAGGAGGCGAGG
TGCCCCGACATGGCGCCGTCGCGGCCGCCAAGGCCAAGGCCGGGGCCGGCGAGGGCCGCC
GTCGTGTACTACCTCTCGAGGAACGGGCACCTCGAGCACCCGCATTTCATGGAGGTTGCC
GTCGCCTCACCTGACGGGCTCTACCTCCGAGATGTGATCGACCGGCTCGACGCGCTCAGA
GGCAAGGGGATGGCGCGCATGTACTCGTGGGCGTCCAAAAGGAGCTACCGGAACGGGTTC
GTGTGGCACGACCTGGCGGACGACGACTACATCTACCCGGTGGCTGGGCGAGAGTACGTG
CTCAAGGGCACGGAGCGGCTGCACCCGATCCAGCTCCCGCTGCTCGACGCGGCCGCCGCG
TCGTCCTGCTCCTCGGGCTCGCAGGAGACGGCCACGTCCTCGCCGCCCGGGTGGGAGAAC
GGCACCGGCGAGGCGCGCCAAAAGAAGGGCGCGGGAATAAACACGTCGGAGCTTTGTGAG
TACAGGGTGTACAAGgccgaggaccccgccgcggcggccgcggacgccgcgacgcagacc
gaggacggttaccgcagcagccgcggtagacacgcccagcgcgccgcggccgcggcggcg
caggaggagctgagcagagaggagacgtcgccgccgacggcgtcgacgagccccgagacg
cTCGAGGCGCTGATCAAGGCGGACGGACGCGTCATGGCGGCCGTCACCGGCGGCGGGAGG
ACCAGGGCGTCGTCCGTGCTCATGCAGCTCATCTCGTGCGGGTCCGTCTCCGTCAAGAGC
ACGCTCGCCTCGCCGGTGATGGCTCGCACCGCCGCGCACTACCGTCCACGGCCACCGCGC
CCACCTACACTCGCGTCGACCACCACCGAGATCCCGAACTACCGCCAAAAGATCGTCGAG
GACAAGGAGTACTTCAGCGGTAGCCTCGTCGAGACGAAGCGCTCGTCGCCGGCCGACACG
TCCCAAGACATTGCCGTTCTCCGGCGGTCATCCTCTTACAACGCCGACAGGGTGCAGAAG
GTGGAGCCGTCGACGGAGGCCGTGGACATGCACGACAGATGCATCCCGCGGAGGCCCAGG
GGCAAGAAGGACGGCGGCGCCTACCTCATCTCCGGCGGGAACGGGCAGTACGGGAGCAAA
AGGCACGGGGGATGAGGAGTTTGGGCTTGGGTTCAGGCTTGCGCCGGTGTGGTGATCTCA
TACTACCTATTGTACGGGATGATAATTCCGAAATTGATACTCCTATATGTTAGCCATTAA
TTATGTTCTGTATATGCCTC

CDS

1236 bp

>Os01t0839200-01 DUF966 family protein, Abiotic stress response
ATGGCAGTGGTGGTGGCTGGCAGCAGGGGGAAAGGGGAGCAGCAGCGGCTGCCGTGGCGA
GAGGCGCAGCAGGAGGCGAGGTGCCCCGACATGGCGCCGTCGCGGCCGCCAAGGCCAAGG
CCGGGGCCGGCGAGGGCCGCCGTCGTGTACTACCTCTCGAGGAACGGGCACCTCGAGCAC
CCGCATTTCATGGAGGTTGCCGTCGCCTCACCTGACGGGCTCTACCTCCGAGATGTGATC
GACCGGCTCGACGCGCTCAGAGGCAAGGGGATGGCGCGCATGTACTCGTGGGCGTCCAAA
AGGAGCTACCGGAACGGGTTCGTGTGGCACGACCTGGCGGACGACGACTACATCTACCCG
GTGGCTGGGCGAGAGTACGTGCTCAAGGGCACGGAGCGGCTGCACCCGATCCAGCTCCCG
CTGCTCGACGCGGCCGCCGCGTCGTCCTGCTCCTCGGGCTCGCAGGAGACGGCCACGTCC
TCGCCGCCCGGGTGGGAGAACGGCACCGGCGAGGCGCGCCAAAAGAAGGGCGCGGGAATA
AACACGTCGGAGCTTTGTGAGTACAGGGTGTACAAGgccgaggaccccgccgcggcggcc
gcggacgccgcgacgcagaccgaggacggttaccgcagcagccgcggtagacacgcccag
cgcgccgcggccgcggcggcgcaggaggagctgagcagagaggagacgtcgccgccgacg
gcgtcgacgagccccgagacgcTCGAGGCGCTGATCAAGGCGGACGGACGCGTCATGGCG
GCCGTCACCGGCGGCGGGAGGACCAGGGCGTCGTCCGTGCTCATGCAGCTCATCTCGTGC
GGGTCCGTCTCCGTCAAGAGCACGCTCGCCTCGCCGGTGATGGCTCGCACCGCCGCGCAC
TACCGTCCACGGCCACCGCGCCCACCTACACTCGCGTCGACCACCACCGAGATCCCGAAC
TACCGCCAAAAGATCGTCGAGGACAAGGAGTACTTCAGCGGTAGCCTCGTCGAGACGAAG
CGCTCGTCGCCGGCCGACACGTCCCAAGACATTGCCGTTCTCCGGCGGTCATCCTCTTAC
AACGCCGACAGGGTGCAGAAGGTGGAGCCGTCGACGGAGGCCGTGGACATGCACGACAGA
TGCATCCCGCGGAGGCCCAGGGGCAAGAAGGACGGCGGCGCCTACCTCATCTCCGGCGGG
AACGGGCAGTACGGGAGCAAAAGGCACGGGGGATGA

Protein

412 aa

>Os01t0839200-01 DUF966 family protein, Abiotic stress response
MAVVVAGSRGKGEQQRLPWREAQQEARCPDMAPSRPPRPRPGPARAAVVYYLSRNGHLEH
PHFMEVAVASPDGLYLRDVIDRLDALRGKGMARMYSWASKRSYRNGFVWHDLADDDYIYP
VAGREYVLKGTERLHPIQLPLLDAAAASSCSSGSQETATSSPPGWENGTGEARQKKGAGI
NTSELCEYRVYKAEDPAAAAADAATQTEDGYRSSRGRHAQRAAAAAAQEELSREETSPPT
ASTSPETLEALIKADGRVMAAVTGGGRTRASSVLMQLISCGSVSVKSTLASPVMARTAAH
YRPRPPRPPTLASTTTEIPNYRQKIVEDKEYFSGSLVETKRSSPADTSQDIAVLRRSSSY
NADRVQKVEPSTEAVDMHDRCIPRRPRGKKDGGAYLISGGNGQYGSKRHGG*

5'UTR

chr01:36004962..36005000 (- strand) : 39 bp

CDS

chr01:36004730..36004961 (- strand) : 232 bp

chr01:36004543..36004612 (- strand) : 70 bp

chr01:36003650..36004438 (- strand) : 789 bp

chr01:36002684..36002828 (- strand) : 145 bp

3'UTR

chr01:36002559..36002683 (- strand) : 125 bp

FASTA

>Os01t0839200-01 class=Sequence position=chr01:36002559..36005000 (- strand)
AGCAGCAGCA GCCAGCAAGG GTAGGTTAGG TTGACGAGGA TGGCAGTGGT GGTGGCTGGC AGCAGGGGGA AAGGGGAGCA
GCAGCGGCTG CCGTGGCGAG AGGCGCAGCA GGAGGCGAGG TGCCCCGACA TGGCGCCGTC GCGGCCGCCA AGGCCAAGGC
CGGGGCCGGC GAGGGCCGCC GTCGTGTACT ACCTCTCGAG GAACGGGCAC CTCGAGCACC CGCATTTCAT GGAGGTTGCC
GTCGCCTCAC CTGACGGGCT CTACCTCCGA GGTACGTGCG TGTGCTCAGC TTGATCGTCT CGTCGTCGCG CGTTTCGGTT
TTTCTTTTGT TTTTGTTGCT GCATTCGCCG CCGTTCCGTG ACGTCGTCGT CGTCGTTGCT GTGCGTAGAT GTGATCGACC
GGCTCGACGC GCTCAGAGGC AAGGGGATGG CGCGCATGTA CTCGTGGGCG TCCAAAAGGT TAGTTTTTTT CACGAACTTG
TTCTTGTTGT GGCTTGCTTG CCAGTGAGGT GCAAGCGAGC ATTGGACATG GGATCGTCCT CAATGTTGTG GCAATATTGC
AGGAGCTACC GGAACGGGTT CGTGTGGCAC GACCTGGCGG ACGACGACTA CATCTACCCG GTGGCTGGGC GAGAGTACGT
GCTCAAGGGC ACGGAGCGGC TGCACCCGAT CCAGCTCCCG CTGCTCGACG CGGCCGCCGC GTCGTCCTGC TCCTCGGGCT
CGCAGGAGAC GGCCACGTCC TCGCCGCCCG GGTGGGAGAA CGGCACCGGC GAGGCGCGCC AAAAGAAGGG CGCGGGAATA
AACACGTCGG AGCTTTGTGA GTACAGGGTG TACAAGgccg aggaccccgc cgcggcggcc gcggacgccg cgacgcagac
cgaggacggt taccgcagca gccgcggtag acacgcccag cgcgccgcgg ccgcggcggc gcaggaggag ctgagcagag
aggagacgtc gccgccgacg gcgtcgacga gccccgagac gcTCGAGGCG CTGATCAAGG CGGACGGACG CGTCATGGCG
GCCGTCACCG GCGGCGGGAG GACCAGGGCG TCGTCCGTGC TCATGCAGCT CATCTCGTGC GGGTCCGTCT CCGTCAAGAG
CACGCTCGCC TCGCCGGTGA TGGCTCGCAC CGCCGCGCAC TACCGTCCAC GGCCACCGCG CCCACCTACA CTCGCGTCGA
CCACCACCGA GATCCCGAAC TACCGCCAAA AGATCGTCGA GGACAAGGAG TACTTCAGCG GTAGCCTCGT CGAGACGAAG
CGCTCGTCGC CGGCCGACAC GTCCCAAGAC ATTGCCGTTC TCCGGCGGTC ATCCTCTTAC AACGCCGACA GGTACACCAA
TCCATCCATA GCTGGTTAAT TAGTCGCAAA ACATCAATGC AAATCAATGT TCAACGCCAG TATCCAAATC GGTACGACCA
GTTAGTTACC ATGCCGTAGC AGTTTAGAAC TCCATTTGGT TGGTTGAATG GTTGCCTCTA AATCTCTCGT AGAGTCGTAG
TTGTAAGGAA TAACACATGA ACTGGTACTG TTGCATTGAA CCATACTGCC GTGGCGGCAG TTAAGAATTG CTAGTGCGGC
ACTGAACTCC TCTGCAAATG CCATTGCTGT ACATGCAAGA TATGAGGAGT AGTGTACCTG ATTAGTGGTT GCGTTCATAA
ATGGAAGTAG GTCTCGCGGA GCTGTCTCGC ACAGAGCCGA CGGGATGAAT GGGGAATGTC AGGGACGGGG CTTGAATTCT
CGTCCCGCCC TAATTAATCC ATGCGAGCCT TCATCGAAAA GCCTTGATTA GCTCGTTGAG AGCCATATCG CGTCAATGAT
AAGCCGCACT CAATCACGTG TGTGACGAGG TGAGGGATCG GAGTAACTAA TGAATATGAC GCGAGCTCCT AGCAGCAGTA
GCACCAGCCT TTGTCAGCAA TTTGAAGTCA TTGAACTCTG CTTTAAGCGT GGTCCAGAGC CCTAACCCAG AACCTGATAA
CGTAGTTATC ATCATATCTG CTGCTGCACG GCGCTCGCCG TTGCTTAAAA AGAACCCAAT ACTACTAGCC AGGCTAGCCT
GCCTCTGTGT GGCGTCATGG AGTACGATGA GAATATGATG ATGATGAGTT GGTGATATGA TGGTATGCTA TCTCTGCCTC
GCGGCATGGC AGGGTGCAGA AGGTGGAGCC GTCGACGGAG GCCGTGGACA TGCACGACAG ATGCATCCCG CGGAGGCCCA
GGGGCAAGAA GGACGGCGGC GCCTACCTCA TCTCCGGCGG GAACGGGCAG TACGGGAGCA AAAGGCACGG GGGATGAGGA
GTTTGGGCTT GGGTTCAGGC TTGCGCCGGT GTGGTGATCT CATACTACCT ATTGTACGGG ATGATAATTC CGAAATTGAT
ACTCCTATAT GTTAGCCATT AATTATGTTC TGTATATGCC TC

Locus: Os01g0839200

Loading...

Locus: Os01g0839200

Loading...