Os01t0839700-01

Locus

Os01g0839700

Description

Similar to Ubiquitin carrier protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC11

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 11

Oryzabase Gene Symbol Synonym(s)

OsUBC11

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 11

Transcript Evidence

AK112030 (DDBJ, Best hit)

Protein Evidence

A2WWU3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

001-039-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0839700-01)

Others

Oryzabase (19558)

Transcript

1158 bp

>Os01t0839700-01 Similar to Ubiquitin carrier protein.
GTGCTTCCCATTTTATCCGCCTGCTCTGCTGCTCCACATTTTCTCCCTCTTTCCTTCCCT
TATCGTCCTCTCTCTCCTTCTTCCTTTCCTGATTCATCTCGCCGAGCTCTCCTCGTCGCC
TCCTCCGTCTCTCTATAAATAAGGCGCCCCACGGCGCCTATCGATTCGCGTCGCCGCTTC
CTGCAGAGGCCGAGAATTATTCTCCTGCGCCCGCCGCAAAAACCCTAGCCACGCCGATCT
CATGGCGGCTACCATCAGCCAGGCGAGCCTCCTCCTGCAGAAGCAGCTGAAAGATCTCGC
GAAGCACCCCGTGGATGGGTTCTCGGCTGGGTTAGTCGACGACAGCAACGTCTTCGAGTG
GCAGGTCACAATCATCGGCCCGCCTGACACCCTATATGATGGAGGTTACTTTAATGCAAT
AATGAGCTTTCCACAGAATTATCCTAACAGTCCTCCAACTGTCAGATTTACCTCAGAAAT
GTGGCATCCAAATGTTTATCCGGATGGACGTGTATGCATTTCTATTCTTCATCCGCCTGG
TGATGATCCCAATGGTTATGAGCTTGCGAGTGAGCGTTGGACACCAGTGCATACGGTTGA
GAGCATAGTTCTGAGCATCATTTCGATGCTTTCTGGTCCAAATGATGAATCACCAGCAAA
TATTGAAGCAGCTAAGGAATGGAGAGAGAAGAGGGATGACTTCAAGAAAAAGGTTAGGCG
CCTTGTAAGGAAATCACAAGAAATGCTCTGAAGAAACCGGCAGTACTGGGGAAAGTTAAC
CATACCACGTCACATGTGCATGATTTGGCTGTCGATTTCCAAATGTCAGTTGACACTAGC
AATTCACTTCTCCCCCTCTGTACTTCCCATAGTGTGCCTGGTGGTGGTCGCGGTTTCGTC
TCCCAGGAAGGCTGAATAGCACTGGGACATGTTTGTCACCTATTCTAAAGCTCTGGTTGT
ATTTGTGTGGCTTGGGCTGTAAACGTTGAGAAACTTTGAAATACTGCCACTCATCACAAT
TTTCGTAACAAACGTCATATAAGCAGGCACCTGCCTGATCTGCTAGCTGTTGAACGTTGA
AACACAATGTCTGCAAACTGGTTTCAGTCCGTTCTTTGTAATATGTTCTTATAAATGGAG
CAATACTCGGTGCTGTAC

CDS

510 bp

>Os01t0839700-01 Similar to Ubiquitin carrier protein.
ATGGCGGCTACCATCAGCCAGGCGAGCCTCCTCCTGCAGAAGCAGCTGAAAGATCTCGCG
AAGCACCCCGTGGATGGGTTCTCGGCTGGGTTAGTCGACGACAGCAACGTCTTCGAGTGG
CAGGTCACAATCATCGGCCCGCCTGACACCCTATATGATGGAGGTTACTTTAATGCAATA
ATGAGCTTTCCACAGAATTATCCTAACAGTCCTCCAACTGTCAGATTTACCTCAGAAATG
TGGCATCCAAATGTTTATCCGGATGGACGTGTATGCATTTCTATTCTTCATCCGCCTGGT
GATGATCCCAATGGTTATGAGCTTGCGAGTGAGCGTTGGACACCAGTGCATACGGTTGAG
AGCATAGTTCTGAGCATCATTTCGATGCTTTCTGGTCCAAATGATGAATCACCAGCAAAT
ATTGAAGCAGCTAAGGAATGGAGAGAGAAGAGGGATGACTTCAAGAAAAAGGTTAGGCGC
CTTGTAAGGAAATCACAAGAAATGCTCTGA

Protein

170 aa

>Os01t0839700-01 Similar to Ubiquitin carrier protein.
MAATISQASLLLQKQLKDLAKHPVDGFSAGLVDDSNVFEWQVTIIGPPDTLYDGGYFNAI
MSFPQNYPNSPPTVRFTSEMWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVE
SIVLSIISMLSGPNDESPANIEAAKEWREKRDDFKKKVRRLVRKSQEML*

5'UTR

chr01:36023228..36023468 (- strand) : 241 bp

CDS

chr01:36023176..36023227 (- strand) : 52 bp

chr01:36022954..36023056 (- strand) : 103 bp

chr01:36019247..36019344 (- strand) : 98 bp

chr01:36019062..36019162 (- strand) : 101 bp

chr01:36018182..36018259 (- strand) : 78 bp

chr01:36017665..36017742 (- strand) : 78 bp

3'UTR

chr01:36017258..36017664 (- strand) : 407 bp

FASTA

>Os01t0839700-01 class=Sequence position=chr01:36017258..36023468 (- strand)
GTGCTTCCCA TTTTATCCGC CTGCTCTGCT GCTCCACATT TTCTCCCTCT TTCCTTCCCT TATCGTCCTC TCTCTCCTTC
TTCCTTTCCT GATTCATCTC GCCGAGCTCT CCTCGTCGCC TCCTCCGTCT CTCTATAAAT AAGGCGCCCC ACGGCGCCTA
TCGATTCGCG TCGCCGCTTC CTGCAGAGGC CGAGAATTAT TCTCCTGCGC CCGCCGCAAA AACCCTAGCC ACGCCGATCT
CATGGCGGCT ACCATCAGCC AGGCGAGCCT CCTCCTGCAG AAGCAGCTGA AAGGTGCGGA TCCATGCGGC TCGCTTCGTC
CTCGTTCGTC GGTGTTCTGT TTGCGCCCCT TTTTTTTCAT CCGTGGATTG ATCGATTTCG GGGTTGGGTT TGTGGTTTGG
TGATTGGTGC AGATCTCGCG AAGCACCCCG TGGATGGGTT CTCGGCTGGG TTAGTCGACG ACAGCAACGT CTTCGAGTGG
CAGGTCACAA TCATCGGCCC GCCTGACACC CTATAGTGAG TTGGATTCTC TCTCCAATTC GATGCATGCT TCCATGAATC
ATCTGCCTCA TCCGTGTTCA TGCCATGCGA GTGGAGTTTT TTCGTGTATA CCCGCGAATT GGAGGCAGAA TCTTGAATTC
GTTTCTAACC GTGGCTTGAG GTTGGCTTCC GATTGAATTT TGCGATGATT TTAGGTTCTT GGAAGGTTTG CATAGCTACC
ACAGTCCTAC GACTAGCTTT CATGGTTGAT GCCCATTTCA ATGAGTTTGG TTTGAACTGG ATGTGTGGAT GAGGCATGGG
TAGCTCGTTT TGCAGGATGG GTTTGTTGAA GTGGTGGCAG TTTGCATGTT CACATTTAGA TTGCGCATAT TTCTATATGC
ATATGTGTGG GTAAAGGTTC ATGACAGTCT GGGGTCAGAT TCTTAAACTA CATCATGGAA ATGGAAACCT ATGTATCGAT
TAGACTGACT GTGTTTTTCT ATTAATGGGG ATAAACTGGG CAGCTCATGT TCTCAATGTA AGAGTTTATG CCCTCATAAA
ATTTTGGGGA AGATATGCTT CAGCTTATTT ATTAGTGCTT TCTTGCCGGT AATTGACCTG GCAAGTTTTT CACTCTTGTT
TCAAGTAGTA CCGATGTATC AACCAAGTTA CATTCTAATT TCATCTGGTG TTTGGTGCAT GAATGGATTT TTCTTTCGTA
GAATTTATGT TTAAAATCCA GAAATCCGTC CAGAGCAGCT AGTTTGCACT ATTGGACCAC ATGCTGGAAA TACAATAGTC
CAATCTAATG AGTGATAAAT GGATTAACAT AAAGGTACAG GGATGCTGTT TTAGGAAAGG AACCCGAAGA ACTGGCAGTA
GGTTCAACTC AACCTGCATG TGACATAATT AAAACTAGCT GAATTTCCAA TGCAATGGGG ATAGACTATT AGATATACAA
TCGCATTTGC TATGCATCTT TCAGGTTTAT TTGTAAAATT ACAATTGCCA TACTGCTGTT TTAATTATGT AATAGATGGA
GTAATGAGTG TGGTTACTAG TTGCAAACTA CAACACCACA TCTATTATAT TATTAAGACA GCTCGAAAAG AAGGCACCAC
GTTCACCGTG GAGGCTAGAA ATTTTCACAT TAATCGGGGA AAAAGAAAAA ACCTACACCG TTAGATCATA ACAAATCTAG
ACTATAAGGG TTGAGATTTA ATCAAAATAT ATGTAAAAGC TTGACTCTTT GACTTTTTGA ATCGGACACG TGAAAGAGCG
TGGAACTAGA ATTTTGGTGC ATGCTATGCA GTAGCCTTTG AAATCAAAAT CAAATTAGGA AACTTAATTT ACTGACACGA
GACAAACACG TCATGTCTGC ATAGCAAAAT TAGAAATCAT AAATATGCAC AACTGTGACA CGTCCTGTAC AAAATCATGT
GTAGGGGAGA CAAAACAACT GGGCATCCAA ACTCCTTCAA CCACATTCAA GTTTTGCACT ATCGCATAAT CTTTAGAGAC
AATATGTTTT TTTAAAATAA AATTCTTAGT AACAAGATTC CCTAATAGCT TTCTCTGTAT TTAGGGTCCA TATGTTATAG
CTCATACTCC GAGAATGGGG CAATGCTGAG AAGCGGCGGA AATCACCATA TTAATAATAA AAAGTGAAGT ATTTAAAGGA
TCTAAATTTT AATGGTGTAT ATTGATCGAT GTAGTTTTAT ATAAATAAAA TATTCTATCT ATTATTTTaa taaagtaatg
taaaaagaag tctctacgtt tgctctcaag acttacaaat tctcggatta aaaaatataa gcagttggat catggtcatg
cctgtaaaga aattgagtgg tgacggttga tgggacatct acaaatttga aaaaaaaccc aaatagaatc ccaatgagga
ttaagagggg gaacgatgga tagatcgtta tgcggtatgg ttatagcggt tggctggact tctagaaaga aacaaaaaat
aaacccaatg ataatcatgt acaattttta aaatatcaaa aacaataaag aggggaggca acaggcgagc tgtagatgag
tacattggca aagccattaa cggattggcg gaacttctag aaagtaaaag ctgaactaac acgataatta tgtttgtttt
tttaaaatcc caatgaaaat aaagagaaga ggcagtgggc accccataaa ggagtacagt ggcggtgttt aacaggactt
ctaaaaatta tagaagagtt catgcaggaa tacaatttat aaataaaatg ccagaataaa gaatatagaa ttttcaaaaa
aaaaagtcca tctagaatac aatgatgaca aatgataata aaaaggagaa acaacatgcc tgtaaagtag tagatgacgg
ttgatggtac atctaaaaat tataaacaga actccaaata gaatcccaat taagattaag aggaggaaca cagacatgtt
gttaagtagc actgtcacaa cgtttgaggg gaggcagcgg gcgagccata gaagagtaca gtggcaaagc cgttgatggt
ttggcaggat ttctagaaat taacaaataa actccaatga taatcatgtt taaattttaa aatatcaata ataacaaaga
ggggaagcag tggacgagcc gtagaggagt acattggcaa agccgctaaa ggtttggcgg gacttcttag ataattatgt
tcgaatttta aaatcccaat attaataaag agatgaggca gtggacgggc cgtagaggag tacaatggta gcgtttgacg
ggactttcta gataattatg ttcgattttt aaaatcccaa tgttaataaa gagaggatag tggactggcc gtagagaagt
acattggcag catttgacgg aacttctaaa tattataaaa atgaaaccaa acaagccaat aaactctaaa aactacaaga
tataattttt aaggttctaa ggagaatgaa tagaagcaat agtagatcga gcaagcaaat aacggagatg tgacaaagga
gtaagtggta gcgaccgacg tgactcttat aaactataaa agtagaaaca ccgagatgat aaggttcggt ccaatgtccc
aagacaacga gatagttgtt taacaaattt taagtaaaat catatgtaaa agatagatag ttttgtacgg atgctagccg
cgcaattgcg cgggccaccc agctagttat ttgaaagaaa ACTAAAGAAT AGTCTCGGTA AGCTTAAAAT GGAATCGTGC
ACTCTTGTCA GGGAGCTTGC ATATGCGTTC AATATATTTT CTACTTTCAA ATAATGCGCT CTTTGGTGTT TTCTTGGCTT
GGACAGAAGG ATTCTTTACA CATTAAACGA ATTTACTGGT TTGCTTGTTC CATGGTCCAG AATCTCAAAT GTGTAAACAT
TTGATATGAG CTCAAAATGA GTTAGCTACT ATGGTTTAAA CTTCTAGTAA GTGGTAACTG ATAACAGTCC TTATTTCAGA
TATAGAGCCC TTTTCATGTG CTTGCTGATT TGTCATCTAT TCATCTTTGG TGTTTGGGCT GTTAGCTTGA TGATCTAAAC
TGTTCTTTCT CAAACTGCCT TGTGACAATG ACATTTATTT TCAGTGATGG AGGTTACTTT AATGCAATAA TGAGCTTTCC
ACAGAATTAT CCTAACAGTC CTCCAACTGT CAGATTTACC TCAGAAATGT GGCATCCAAA TGGTCAGCTT TCCTCATTGT
AACTTCATGT TTCTGTAACT CCATGATCCA TAATTTTAAC ACAGCATAAT ATTGGTCAAT TGCCAGTTTA TCCGGATGGA
CGTGTATGCA TTTCTATTCT TCATCCGCCT GGTGATGATC CCAATGGTTA TGAGCTTGCG AGTGAGCGTT GGACACCAGT
GCATACGGTA CGAATTATGG TGTCTATGAT GCAAGCAATT TCTTCCCTTT TCATTCTGTT CTGCACTAGT TCCATTTTGT
TGACAACTTG ACATATATTC TGCGTGGAGG CCTGGAGGGT ATTGTCTGCT GAATTTTCTT ACATAAATAA TCAATAAGCT
TTGACAAAGG AAAGAGCTTG TGATGCAAAT TTGGGAGTTT GTTAAGCATC TGCAATGCAA TACACGGGCA TAACACCACA
CTGCAAATAT TTCCTAAAAT TGTGAACAAT GATGATGGCT TTGTTTTGCA TTTTGGATAT TCATGATAAC TTTTTTGCCT
TCCACCTAGA GTTTCGTTTT TGTAATCCTT TTATCTCTAA TATTGTTACT GTAAAGTGCA ATGCGTTATT TTCTTTGGAC
TAGCAAGTTA TTAAACTTGC ATAAGAATCT TTGTGCATCT GATATTATCT AGTTCAGATA GTAAATCCTT TCAAACTTCA
AAGTATAAGA AGCCTTATAT GTAGAGTTGG TGTAACCTTC GGTAATTTAT AGTATGATAG CTTGAAACAT CACTACAAAT
TCCATCGTTG ACATATCAAA CTCAGCTTCT GGTATACTGA AAAGTCAAAA GTAATTGTAG CATTTGAATC TTGCATTTGA
ATAATAGTCA TATTTTGAAC AATGCTGCAA AGTTACTTGT TTGTTTTGTC ACTGATCTTG TCATGATCAT ATGTTTATCT
TCTCTAGCTT TTTGTAAGTA GCCATTTTTT ACTGTCTAAT CATCATATTC CTGATTCTTG TAATTTTAAT GAGTGTTTTC
CATTTACAGG TTGAGAGCAT AGTTCTGAGC ATCATTTCGA TGCTTTCTGG TCCAAATGAT GAATCACCAG CAAATATTGA
AGCAGCTGTA AGTTCACTTA ACATTTGCTA TGGAAATTGA GAACTCTGTT CCTCCTGGGC CTTGGTGTAT ATGGCATTTT
ATCTGTCACG GAGGGATGGG GGAAGAGTTG AAGTACTTGT CAATAGGGAA AACACAGAGT TGGCAGATCC TACAAAATAA
TCTAACTTCC AGTCCAAAAA CCATTTAACT TTATTATCAA CATTTGCATA CTGGATTCTG CATGTACCTT TCATCTTAGA
TATTCACCTA TTTATTTGGT TAGTTGCAGC CCTGAGAATT TTCTCAGGTA CTGCTATAGT CCTTGAAACA TCTGTGAATT
TACACACCAG ACATTTGAAT GACTTTTTAA ACACACAGAA AATTGTAGTC AGGACAATGC GTAGTGTATT TTGCCTGCTG
TTTGGTGGAC CTTTGTTCTG AACTTCTGCC TACTGTTCTT GCGCAGAAGG AATGGAGAGA GAAGAGGGAT GACTTCAAGA
AAAAGGTTAG GCGCCTTGTA AGGAAATCAC AAGAAATGCT CTGAAGAAAC CGGCAGTACT GGGGAAAGTT AACCATACCA
CGTCACATGT GCATGATTTG GCTGTCGATT TCCAAATGTC AGTTGACACT AGCAATTCAC TTCTCCCCCT CTGTACTTCC
CATAGTGTGC CTGGTGGTGG TCGCGGTTTC GTCTCCCAGG AAGGCTGAAT AGCACTGGGA CATGTTTGTC ACCTATTCTA
AAGCTCTGGT TGTATTTGTG TGGCTTGGGC TGTAAACGTT GAGAAACTTT GAAATACTGC CACTCATCAC AATTTTCGTA
ACAAACGTCA TATAAGCAGG CACCTGCCTG ATCTGCTAGC TGTTGAACGT TGAAACACAA TGTCTGCAAA CTGGTTTCAG
TCCGTTCTTT GTAATATGTT CTTATAAATG GAGCAATACT CGGTGCTGTA C

Locus: Os01g0839700

Loading...

Locus: Os01g0839700

Loading...