Os01t0839700-02

Locus

Os01g0839700

Description

Similar to Ubiquitin carrier protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC11

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 11

Oryzabase Gene Symbol Synonym(s)

OsUBC11

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 11

Transcript Evidence

AK104148 (DDBJ, Best hit)

Protein Evidence

A2WWU3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

006-208-B05 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0839700-02)

RiceXPro (AK104148)

Others

Oryzabase (19558)

KEGG (Os01t0839700-02 (EC:6.3.2.19))

Transcript

1123 bp

>Os01t0839700-02 Similar to Ubiquitin carrier protein.
CTGATTCATCTCGCCGAGCTCTCCTCGTCGCCTCCTCCGTCTCTCTATAAATAAGGCGCC
CCACGGCGCCTATCGATTCGCGTCGCCGCTTCCTGCAGAGGCCGAGAATTATTCTCCTGC
GCCCGCCGCAAAAACCCTAGCCACGCCGATCTCATGGCGGCTACCATCAGCCAGGCGAGC
CTCCTCCTGCAGAAGCAGCTGAAAGATCTCGCGAAGCACCCCGTGGATGGGTTCTCGGCT
GGGTTAGTCGACGACAGCAACGTCTTCGAGTGGCAGGTCACAATCATCGGCCCGCCTGAC
ACCCTATATGATGGAGGTTACTTTAATGCAATAATGAGCTTTCCACAGAATTATCCTAAC
AGTCCTCCAACTGTCAGATTTACCTCAGAAATGTGGCATCCAAATGTTTATCCGGATGGA
CGTGTATGCATTTCTATTCTTCATCCGCCTGGTGATGATCCCAATGGTTATGAGCTTGCG
AGTGAGCGTTGGACACCAGTGCATACGGTTGAGAGCATAGTTCTGAGCATCATTTCGATG
CTTTCTGGTCCAAATGATGAATCACCAGCAAATATTGAAGCAGCTAAGGAATGGAGAGAG
AAGAGGGATGACTTCAAGAAAAAGGTTAGGCGCCTTGTAAGGAAATCACAAGAAATGCTC
TGAAGAAACCGGCAGTACTGGGGAAAGTTAACCATACCACGTCACATGTGCATGATTTGG
CTGTCGATTTCCAAATGTCAGTTGACACTAGCAATTCACTTCTCCCCCTCTGTACTTCCC
ATAGTGTGCCTGGTGGTGGTCGCGGTTTCGTCTCCCAGGAAGGCTGAATAGCACTGGGAC
ATGTTTGTCACCTATTCTAAAGCTCTGGTTGTATTTGTGTGGCTTGGGCTGTAAACGTTG
AGAAACTTTGAAATACTGCCACTCATCACAATTTTCGTAACAAACGTCATATAAGCAGGC
ACCTGCCTGATCTGCTAGCTGTTGAACGTTGAAACACAATGTCTGCAAACTGGTTTCAGT
CCGTTCTTTGTAATATGTTCTTATAAATGGAGCAATACTCGGTGCTGTACAAAAATACTT
GCTGGAGTTTACTCATTCATCAGTTATAAATCTATATTGGCTT

CDS

510 bp

>Os01t0839700-02 Similar to Ubiquitin carrier protein.
ATGGCGGCTACCATCAGCCAGGCGAGCCTCCTCCTGCAGAAGCAGCTGAAAGATCTCGCG
AAGCACCCCGTGGATGGGTTCTCGGCTGGGTTAGTCGACGACAGCAACGTCTTCGAGTGG
CAGGTCACAATCATCGGCCCGCCTGACACCCTATATGATGGAGGTTACTTTAATGCAATA
ATGAGCTTTCCACAGAATTATCCTAACAGTCCTCCAACTGTCAGATTTACCTCAGAAATG
TGGCATCCAAATGTTTATCCGGATGGACGTGTATGCATTTCTATTCTTCATCCGCCTGGT
GATGATCCCAATGGTTATGAGCTTGCGAGTGAGCGTTGGACACCAGTGCATACGGTTGAG
AGCATAGTTCTGAGCATCATTTCGATGCTTTCTGGTCCAAATGATGAATCACCAGCAAAT
ATTGAAGCAGCTAAGGAATGGAGAGAGAAGAGGGATGACTTCAAGAAAAAGGTTAGGCGC
CTTGTAAGGAAATCACAAGAAATGCTCTGA

Protein

170 aa

>Os01t0839700-02 Similar to Ubiquitin carrier protein.
MAATISQASLLLQKQLKDLAKHPVDGFSAGLVDDSNVFEWQVTIIGPPDTLYDGGYFNAI
MSFPQNYPNSPPTVRFTSEMWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVE
SIVLSIISMLSGPNDESPANIEAAKEWREKRDDFKKKVRRLVRKSQEML*

5'UTR

chr01:36023228..36023380 (- strand) : 153 bp

CDS

chr01:36023176..36023227 (- strand) : 52 bp

chr01:36022954..36023056 (- strand) : 103 bp

chr01:36019247..36019344 (- strand) : 98 bp

chr01:36019062..36019162 (- strand) : 101 bp

chr01:36018182..36018259 (- strand) : 78 bp

chr01:36017665..36017742 (- strand) : 78 bp

3'UTR

chr01:36017205..36017664 (- strand) : 460 bp

FASTA

>Os01t0839700-02 class=Sequence position=chr01:36017205..36023380 (- strand)
CTGATTCATC TCGCCGAGCT CTCCTCGTCG CCTCCTCCGT CTCTCTATAA ATAAGGCGCC CCACGGCGCC TATCGATTCG
CGTCGCCGCT TCCTGCAGAG GCCGAGAATT ATTCTCCTGC GCCCGCCGCA AAAACCCTAG CCACGCCGAT CTCATGGCGG
CTACCATCAG CCAGGCGAGC CTCCTCCTGC AGAAGCAGCT GAAAGGTGCG GATCCATGCG GCTCGCTTCG TCCTCGTTCG
TCGGTGTTCT GTTTGCGCCC CTTTTTTTTC ATCCGTGGAT TGATCGATTT CGGGGTTGGG TTTGTGGTTT GGTGATTGGT
GCAGATCTCG CGAAGCACCC CGTGGATGGG TTCTCGGCTG GGTTAGTCGA CGACAGCAAC GTCTTCGAGT GGCAGGTCAC
AATCATCGGC CCGCCTGACA CCCTATAGTG AGTTGGATTC TCTCTCCAAT TCGATGCATG CTTCCATGAA TCATCTGCCT
CATCCGTGTT CATGCCATGC GAGTGGAGTT TTTTCGTGTA TACCCGCGAA TTGGAGGCAG AATCTTGAAT TCGTTTCTAA
CCGTGGCTTG AGGTTGGCTT CCGATTGAAT TTTGCGATGA TTTTAGGTTC TTGGAAGGTT TGCATAGCTA CCACAGTCCT
ACGACTAGCT TTCATGGTTG ATGCCCATTT CAATGAGTTT GGTTTGAACT GGATGTGTGG ATGAGGCATG GGTAGCTCGT
TTTGCAGGAT GGGTTTGTTG AAGTGGTGGC AGTTTGCATG TTCACATTTA GATTGCGCAT ATTTCTATAT GCATATGTGT
GGGTAAAGGT TCATGACAGT CTGGGGTCAG ATTCTTAAAC TACATCATGG AAATGGAAAC CTATGTATCG ATTAGACTGA
CTGTGTTTTT CTATTAATGG GGATAAACTG GGCAGCTCAT GTTCTCAATG TAAGAGTTTA TGCCCTCATA AAATTTTGGG
GAAGATATGC TTCAGCTTAT TTATTAGTGC TTTCTTGCCG GTAATTGACC TGGCAAGTTT TTCACTCTTG TTTCAAGTAG
TACCGATGTA TCAACCAAGT TACATTCTAA TTTCATCTGG TGTTTGGTGC ATGAATGGAT TTTTCTTTCG TAGAATTTAT
GTTTAAAATC CAGAAATCCG TCCAGAGCAG CTAGTTTGCA CTATTGGACC ACATGCTGGA AATACAATAG TCCAATCTAA
TGAGTGATAA ATGGATTAAC ATAAAGGTAC AGGGATGCTG TTTTAGGAAA GGAACCCGAA GAACTGGCAG TAGGTTCAAC
TCAACCTGCA TGTGACATAA TTAAAACTAG CTGAATTTCC AATGCAATGG GGATAGACTA TTAGATATAC AATCGCATTT
GCTATGCATC TTTCAGGTTT ATTTGTAAAA TTACAATTGC CATACTGCTG TTTTAATTAT GTAATAGATG GAGTAATGAG
TGTGGTTACT AGTTGCAAAC TACAACACCA CATCTATTAT ATTATTAAGA CAGCTCGAAA AGAAGGCACC ACGTTCACCG
TGGAGGCTAG AAATTTTCAC ATTAATCGGG GAAAAAGAAA AAACCTACAC CGTTAGATCA TAACAAATCT AGACTATAAG
GGTTGAGATT TAATCAAAAT ATATGTAAAA GCTTGACTCT TTGACTTTTT GAATCGGACA CGTGAAAGAG CGTGGAACTA
GAATTTTGGT GCATGCTATG CAGTAGCCTT TGAAATCAAA ATCAAATTAG GAAACTTAAT TTACTGACAC GAGACAAACA
CGTCATGTCT GCATAGCAAA ATTAGAAATC ATAAATATGC ACAACTGTGA CACGTCCTGT ACAAAATCAT GTGTAGGGGA
GACAAAACAA CTGGGCATCC AAACTCCTTC AACCACATTC AAGTTTTGCA CTATCGCATA ATCTTTAGAG ACAATATGTT
TTTTTAAAAT AAAATTCTTA GTAACAAGAT TCCCTAATAG CTTTCTCTGT ATTTAGGGTC CATATGTTAT AGCTCATACT
CCGAGAATGG GGCAATGCTG AGAAGCGGCG GAAATCACCA TATTAATAAT AAAAAGTGAA GTATTTAAAG GATCTAAATT
TTAATGGTGT ATATTGATCG ATGTAGTTTT ATATAAATAA AATATTCTAT CTATTATTTT aataaagtaa tgtaaaaaga
agtctctacg tttgctctca agacttacaa attctcggat taaaaaatat aagcagttgg atcatggtca tgcctgtaaa
gaaattgagt ggtgacggtt gatgggacat ctacaaattt gaaaaaaaac ccaaatagaa tcccaatgag gattaagagg
gggaacgatg gatagatcgt tatgcggtat ggttatagcg gttggctgga cttctagaaa gaaacaaaaa ataaacccaa
tgataatcat gtacaatttt taaaatatca aaaacaataa agaggggagg caacaggcga gctgtagatg agtacattgg
caaagccatt aacggattgg cggaacttct agaaagtaaa agctgaacta acacgataat tatgtttgtt tttttaaaat
cccaatgaaa ataaagagaa gaggcagtgg gcaccccata aaggagtaca gtggcggtgt ttaacaggac ttctaaaaat
tatagaagag ttcatgcagg aatacaattt ataaataaaa tgccagaata aagaatatag aattttcaaa aaaaaaagtc
catctagaat acaatgatga caaatgataa taaaaaggag aaacaacatg cctgtaaagt agtagatgac ggttgatggt
acatctaaaa attataaaca gaactccaaa tagaatccca attaagatta agaggaggaa cacagacatg ttgttaagta
gcactgtcac aacgtttgag gggaggcagc gggcgagcca tagaagagta cagtggcaaa gccgttgatg gtttggcagg
atttctagaa attaacaaat aaactccaat gataatcatg tttaaatttt aaaatatcaa taataacaaa gaggggaagc
agtggacgag ccgtagagga gtacattggc aaagccgcta aaggtttggc gggacttctt agataattat gttcgaattt
taaaatccca atattaataa agagatgagg cagtggacgg gccgtagagg agtacaatgg tagcgtttga cgggactttc
tagataatta tgttcgattt ttaaaatccc aatgttaata aagagaggat agtggactgg ccgtagagaa gtacattggc
agcatttgac ggaacttcta aatattataa aaatgaaacc aaacaagcca ataaactcta aaaactacaa gatataattt
ttaaggttct aaggagaatg aatagaagca atagtagatc gagcaagcaa ataacggaga tgtgacaaag gagtaagtgg
tagcgaccga cgtgactctt ataaactata aaagtagaaa caccgagatg ataaggttcg gtccaatgtc ccaagacaac
gagatagttg tttaacaaat tttaagtaaa atcatatgta aaagatagat agttttgtac ggatgctagc cgcgcaattg
cgcgggccac ccagctagtt atttgaaaga aaACTAAAGA ATAGTCTCGG TAAGCTTAAA ATGGAATCGT GCACTCTTGT
CAGGGAGCTT GCATATGCGT TCAATATATT TTCTACTTTC AAATAATGCG CTCTTTGGTG TTTTCTTGGC TTGGACAGAA
GGATTCTTTA CACATTAAAC GAATTTACTG GTTTGCTTGT TCCATGGTCC AGAATCTCAA ATGTGTAAAC ATTTGATATG
AGCTCAAAAT GAGTTAGCTA CTATGGTTTA AACTTCTAGT AAGTGGTAAC TGATAACAGT CCTTATTTCA GATATAGAGC
CCTTTTCATG TGCTTGCTGA TTTGTCATCT ATTCATCTTT GGTGTTTGGG CTGTTAGCTT GATGATCTAA ACTGTTCTTT
CTCAAACTGC CTTGTGACAA TGACATTTAT TTTCAGTGAT GGAGGTTACT TTAATGCAAT AATGAGCTTT CCACAGAATT
ATCCTAACAG TCCTCCAACT GTCAGATTTA CCTCAGAAAT GTGGCATCCA AATGGTCAGC TTTCCTCATT GTAACTTCAT
GTTTCTGTAA CTCCATGATC CATAATTTTA ACACAGCATA ATATTGGTCA ATTGCCAGTT TATCCGGATG GACGTGTATG
CATTTCTATT CTTCATCCGC CTGGTGATGA TCCCAATGGT TATGAGCTTG CGAGTGAGCG TTGGACACCA GTGCATACGG
TACGAATTAT GGTGTCTATG ATGCAAGCAA TTTCTTCCCT TTTCATTCTG TTCTGCACTA GTTCCATTTT GTTGACAACT
TGACATATAT TCTGCGTGGA GGCCTGGAGG GTATTGTCTG CTGAATTTTC TTACATAAAT AATCAATAAG CTTTGACAAA
GGAAAGAGCT TGTGATGCAA ATTTGGGAGT TTGTTAAGCA TCTGCAATGC AATACACGGG CATAACACCA CACTGCAAAT
ATTTCCTAAA ATTGTGAACA ATGATGATGG CTTTGTTTTG CATTTTGGAT ATTCATGATA ACTTTTTTGC CTTCCACCTA
GAGTTTCGTT TTTGTAATCC TTTTATCTCT AATATTGTTA CTGTAAAGTG CAATGCGTTA TTTTCTTTGG ACTAGCAAGT
TATTAAACTT GCATAAGAAT CTTTGTGCAT CTGATATTAT CTAGTTCAGA TAGTAAATCC TTTCAAACTT CAAAGTATAA
GAAGCCTTAT ATGTAGAGTT GGTGTAACCT TCGGTAATTT ATAGTATGAT AGCTTGAAAC ATCACTACAA ATTCCATCGT
TGACATATCA AACTCAGCTT CTGGTATACT GAAAAGTCAA AAGTAATTGT AGCATTTGAA TCTTGCATTT GAATAATAGT
CATATTTTGA ACAATGCTGC AAAGTTACTT GTTTGTTTTG TCACTGATCT TGTCATGATC ATATGTTTAT CTTCTCTAGC
TTTTTGTAAG TAGCCATTTT TTACTGTCTA ATCATCATAT TCCTGATTCT TGTAATTTTA ATGAGTGTTT TCCATTTACA
GGTTGAGAGC ATAGTTCTGA GCATCATTTC GATGCTTTCT GGTCCAAATG ATGAATCACC AGCAAATATT GAAGCAGCTG
TAAGTTCACT TAACATTTGC TATGGAAATT GAGAACTCTG TTCCTCCTGG GCCTTGGTGT ATATGGCATT TTATCTGTCA
CGGAGGGATG GGGGAAGAGT TGAAGTACTT GTCAATAGGG AAAACACAGA GTTGGCAGAT CCTACAAAAT AATCTAACTT
CCAGTCCAAA AACCATTTAA CTTTATTATC AACATTTGCA TACTGGATTC TGCATGTACC TTTCATCTTA GATATTCACC
TATTTATTTG GTTAGTTGCA GCCCTGAGAA TTTTCTCAGG TACTGCTATA GTCCTTGAAA CATCTGTGAA TTTACACACC
AGACATTTGA ATGACTTTTT AAACACACAG AAAATTGTAG TCAGGACAAT GCGTAGTGTA TTTTGCCTGC TGTTTGGTGG
ACCTTTGTTC TGAACTTCTG CCTACTGTTC TTGCGCAGAA GGAATGGAGA GAGAAGAGGG ATGACTTCAA GAAAAAGGTT
AGGCGCCTTG TAAGGAAATC ACAAGAAATG CTCTGAAGAA ACCGGCAGTA CTGGGGAAAG TTAACCATAC CACGTCACAT
GTGCATGATT TGGCTGTCGA TTTCCAAATG TCAGTTGACA CTAGCAATTC ACTTCTCCCC CTCTGTACTT CCCATAGTGT
GCCTGGTGGT GGTCGCGGTT TCGTCTCCCA GGAAGGCTGA ATAGCACTGG GACATGTTTG TCACCTATTC TAAAGCTCTG
GTTGTATTTG TGTGGCTTGG GCTGTAAACG TTGAGAAACT TTGAAATACT GCCACTCATC ACAATTTTCG TAACAAACGT
CATATAAGCA GGCACCTGCC TGATCTGCTA GCTGTTGAAC GTTGAAACAC AATGTCTGCA AACTGGTTTC AGTCCGTTCT
TTGTAATATG TTCTTATAAA TGGAGCAATA CTCGGTGCTG TACAAAAATA CTTGCTGGAG TTTACTCATT CATCAGTTAT
AAATCTATAT TGGCTT

Locus: Os01g0839700

Loading...

Locus: Os01g0839700

Loading...