Os01t0839700-03

Locus

Os01g0839700

Description

Similar to Ubiquitin carrier protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC11

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 11

Oryzabase Gene Symbol Synonym(s)

OsUBC11

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 11

Transcript Evidence

AK099038 (DDBJ, Best hit)

Protein Evidence

A2WWU3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

J013135H01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0839700-03)

Others

Oryzabase (19558)

Transcript

1110 bp

>Os01t0839700-03 Similar to Ubiquitin carrier protein.
CTCTTTCCTTCCCTTATCGTCCTCTCTCTCCTTCTTCCTTTCCTGATTCATCTCGCCGAG
CTCTCCTCGTCGCCTCCTCCGTCTCTCTATAAATAAGGCGCCCCACGGCGCCTATCGATT
CGCGTCGCCGCTTCCTGCAGAGGCCGAGAATTATTCTCCTGCGCCCGCCGCAAAAACCCT
AGCCACGCCGATCTCATGGCGGCTACCATCAGCCAGGCGAGCCTCCTCCTGCAGAAGCAG
CTGAAAGATCTCGCGAAGCACCCCGTGGATGGGTTCTCGGCTGGGTTAGTCGACGACAGC
AACGTCTTCGAGTGGCAGGTCACAATCATCGGCCCGCCTGACACCCTATATGATGGAGGT
TACTTTAATGCAATAATGAGCTTTCCACAGAATTATCCTAACAGTCCTCCAACTGTCAGA
TTTACCTCAGAAATGTGGCATCCAAATGTTTATCCGGATGGACGTGTATGCATTTCTATT
CTTCATCCGCCTGGTGATGATCCCAATGGTTATGAGCTTGCGAGTGAGCGTTGGACACCA
GTGCATACGGTTGAGAGCATAGTTCTGAGCATCATTTCGATGCTTTCTGGTCCAAATGAT
GAATCACCAGCAAATATTGAAGCAGCTAAGGAATGGAGAGAGAAGAGGGATGACTTCAAG
AAAAAGGTTAGGCGCCTTGTAAGGAAATCACAAGAAATGCTCTGAAGAAACCGGCAGTAC
TGGGGAAAGTTAACCATACCACGTCACATGTGCATGATTTGGCTGTCGATTTCCAAATGT
CAGTTGACACTAGCAATTCACTTCTCCCCCTCTGTACTTCCCATAGTGTGCCTGGTGGTG
GTCGCGGTTTCGTCTCCCAGGAAGGCTGAATAGCACTGGGACATGTTTGTCACCTATTCT
AAAGCTCTGGTTGTATTTGTGTGGCTTGGGCTGTAAACGTTGAGAAACTTTGAAATACTG
CCACTCATCACAATTTTCGTAACAAACGTCATATAAGCAGGCACCTGCCTGATCTGCTAG
CTGTTGAACGTTGAAACACAATGTCTGCAAACTGGTTTCAGTCCGTTCTTTGTAATATGT
TCTTATAAATGGAGCAATACTCGGTGCTGT

CDS

510 bp

>Os01t0839700-03 Similar to Ubiquitin carrier protein.
ATGGCGGCTACCATCAGCCAGGCGAGCCTCCTCCTGCAGAAGCAGCTGAAAGATCTCGCG
AAGCACCCCGTGGATGGGTTCTCGGCTGGGTTAGTCGACGACAGCAACGTCTTCGAGTGG
CAGGTCACAATCATCGGCCCGCCTGACACCCTATATGATGGAGGTTACTTTAATGCAATA
ATGAGCTTTCCACAGAATTATCCTAACAGTCCTCCAACTGTCAGATTTACCTCAGAAATG
TGGCATCCAAATGTTTATCCGGATGGACGTGTATGCATTTCTATTCTTCATCCGCCTGGT
GATGATCCCAATGGTTATGAGCTTGCGAGTGAGCGTTGGACACCAGTGCATACGGTTGAG
AGCATAGTTCTGAGCATCATTTCGATGCTTTCTGGTCCAAATGATGAATCACCAGCAAAT
ATTGAAGCAGCTAAGGAATGGAGAGAGAAGAGGGATGACTTCAAGAAAAAGGTTAGGCGC
CTTGTAAGGAAATCACAAGAAATGCTCTGA

Protein

170 aa

>Os01t0839700-03 Similar to Ubiquitin carrier protein.
MAATISQASLLLQKQLKDLAKHPVDGFSAGLVDDSNVFEWQVTIIGPPDTLYDGGYFNAI
MSFPQNYPNSPPTVRFTSEMWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVE
SIVLSIISMLSGPNDESPANIEAAKEWREKRDDFKKKVRRLVRKSQEML*

5'UTR

chr01:36023228..36023422 (- strand) : 195 bp

CDS

chr01:36023176..36023227 (- strand) : 52 bp

chr01:36022954..36023056 (- strand) : 103 bp

chr01:36019247..36019344 (- strand) : 98 bp

chr01:36019062..36019162 (- strand) : 101 bp

chr01:36018182..36018259 (- strand) : 78 bp

chr01:36017665..36017742 (- strand) : 78 bp

3'UTR

chr01:36017260..36017664 (- strand) : 405 bp

FASTA

>Os01t0839700-03 class=Sequence position=chr01:36017260..36023422 (- strand)
CTCTTTCCTT CCCTTATCGT CCTCTCTCTC CTTCTTCCTT TCCTGATTCA TCTCGCCGAG CTCTCCTCGT CGCCTCCTCC
GTCTCTCTAT AAATAAGGCG CCCCACGGCG CCTATCGATT CGCGTCGCCG CTTCCTGCAG AGGCCGAGAA TTATTCTCCT
GCGCCCGCCG CAAAAACCCT AGCCACGCCG ATCTCATGGC GGCTACCATC AGCCAGGCGA GCCTCCTCCT GCAGAAGCAG
CTGAAAGGTG CGGATCCATG CGGCTCGCTT CGTCCTCGTT CGTCGGTGTT CTGTTTGCGC CCCTTTTTTT TCATCCGTGG
ATTGATCGAT TTCGGGGTTG GGTTTGTGGT TTGGTGATTG GTGCAGATCT CGCGAAGCAC CCCGTGGATG GGTTCTCGGC
TGGGTTAGTC GACGACAGCA ACGTCTTCGA GTGGCAGGTC ACAATCATCG GCCCGCCTGA CACCCTATAG TGAGTTGGAT
TCTCTCTCCA ATTCGATGCA TGCTTCCATG AATCATCTGC CTCATCCGTG TTCATGCCAT GCGAGTGGAG TTTTTTCGTG
TATACCCGCG AATTGGAGGC AGAATCTTGA ATTCGTTTCT AACCGTGGCT TGAGGTTGGC TTCCGATTGA ATTTTGCGAT
GATTTTAGGT TCTTGGAAGG TTTGCATAGC TACCACAGTC CTACGACTAG CTTTCATGGT TGATGCCCAT TTCAATGAGT
TTGGTTTGAA CTGGATGTGT GGATGAGGCA TGGGTAGCTC GTTTTGCAGG ATGGGTTTGT TGAAGTGGTG GCAGTTTGCA
TGTTCACATT TAGATTGCGC ATATTTCTAT ATGCATATGT GTGGGTAAAG GTTCATGACA GTCTGGGGTC AGATTCTTAA
ACTACATCAT GGAAATGGAA ACCTATGTAT CGATTAGACT GACTGTGTTT TTCTATTAAT GGGGATAAAC TGGGCAGCTC
ATGTTCTCAA TGTAAGAGTT TATGCCCTCA TAAAATTTTG GGGAAGATAT GCTTCAGCTT ATTTATTAGT GCTTTCTTGC
CGGTAATTGA CCTGGCAAGT TTTTCACTCT TGTTTCAAGT AGTACCGATG TATCAACCAA GTTACATTCT AATTTCATCT
GGTGTTTGGT GCATGAATGG ATTTTTCTTT CGTAGAATTT ATGTTTAAAA TCCAGAAATC CGTCCAGAGC AGCTAGTTTG
CACTATTGGA CCACATGCTG GAAATACAAT AGTCCAATCT AATGAGTGAT AAATGGATTA ACATAAAGGT ACAGGGATGC
TGTTTTAGGA AAGGAACCCG AAGAACTGGC AGTAGGTTCA ACTCAACCTG CATGTGACAT AATTAAAACT AGCTGAATTT
CCAATGCAAT GGGGATAGAC TATTAGATAT ACAATCGCAT TTGCTATGCA TCTTTCAGGT TTATTTGTAA AATTACAATT
GCCATACTGC TGTTTTAATT ATGTAATAGA TGGAGTAATG AGTGTGGTTA CTAGTTGCAA ACTACAACAC CACATCTATT
ATATTATTAA GACAGCTCGA AAAGAAGGCA CCACGTTCAC CGTGGAGGCT AGAAATTTTC ACATTAATCG GGGAAAAAGA
AAAAACCTAC ACCGTTAGAT CATAACAAAT CTAGACTATA AGGGTTGAGA TTTAATCAAA ATATATGTAA AAGCTTGACT
CTTTGACTTT TTGAATCGGA CACGTGAAAG AGCGTGGAAC TAGAATTTTG GTGCATGCTA TGCAGTAGCC TTTGAAATCA
AAATCAAATT AGGAAACTTA ATTTACTGAC ACGAGACAAA CACGTCATGT CTGCATAGCA AAATTAGAAA TCATAAATAT
GCACAACTGT GACACGTCCT GTACAAAATC ATGTGTAGGG GAGACAAAAC AACTGGGCAT CCAAACTCCT TCAACCACAT
TCAAGTTTTG CACTATCGCA TAATCTTTAG AGACAATATG TTTTTTTAAA ATAAAATTCT TAGTAACAAG ATTCCCTAAT
AGCTTTCTCT GTATTTAGGG TCCATATGTT ATAGCTCATA CTCCGAGAAT GGGGCAATGC TGAGAAGCGG CGGAAATCAC
CATATTAATA ATAAAAAGTG AAGTATTTAA AGGATCTAAA TTTTAATGGT GTATATTGAT CGATGTAGTT TTATATAAAT
AAAATATTCT ATCTATTATT TTaataaagt aatgtaaaaa gaagtctcta cgtttgctct caagacttac aaattctcgg
attaaaaaat ataagcagtt ggatcatggt catgcctgta aagaaattga gtggtgacgg ttgatgggac atctacaaat
ttgaaaaaaa acccaaatag aatcccaatg aggattaaga gggggaacga tggatagatc gttatgcggt atggttatag
cggttggctg gacttctaga aagaaacaaa aaataaaccc aatgataatc atgtacaatt tttaaaatat caaaaacaat
aaagagggga ggcaacaggc gagctgtaga tgagtacatt ggcaaagcca ttaacggatt ggcggaactt ctagaaagta
aaagctgaac taacacgata attatgtttg tttttttaaa atcccaatga aaataaagag aagaggcagt gggcacccca
taaaggagta cagtggcggt gtttaacagg acttctaaaa attatagaag agttcatgca ggaatacaat ttataaataa
aatgccagaa taaagaatat agaattttca aaaaaaaaag tccatctaga atacaatgat gacaaatgat aataaaaagg
agaaacaaca tgcctgtaaa gtagtagatg acggttgatg gtacatctaa aaattataaa cagaactcca aatagaatcc
caattaagat taagaggagg aacacagaca tgttgttaag tagcactgtc acaacgtttg aggggaggca gcgggcgagc
catagaagag tacagtggca aagccgttga tggtttggca ggatttctag aaattaacaa ataaactcca atgataatca
tgtttaaatt ttaaaatatc aataataaca aagaggggaa gcagtggacg agccgtagag gagtacattg gcaaagccgc
taaaggtttg gcgggacttc ttagataatt atgttcgaat tttaaaatcc caatattaat aaagagatga ggcagtggac
gggccgtaga ggagtacaat ggtagcgttt gacgggactt tctagataat tatgttcgat ttttaaaatc ccaatgttaa
taaagagagg atagtggact ggccgtagag aagtacattg gcagcatttg acggaacttc taaatattat aaaaatgaaa
ccaaacaagc caataaactc taaaaactac aagatataat ttttaaggtt ctaaggagaa tgaatagaag caatagtaga
tcgagcaagc aaataacgga gatgtgacaa aggagtaagt ggtagcgacc gacgtgactc ttataaacta taaaagtaga
aacaccgaga tgataaggtt cggtccaatg tcccaagaca acgagatagt tgtttaacaa attttaagta aaatcatatg
taaaagatag atagttttgt acggatgcta gccgcgcaat tgcgcgggcc acccagctag ttatttgaaa gaaaACTAAA
GAATAGTCTC GGTAAGCTTA AAATGGAATC GTGCACTCTT GTCAGGGAGC TTGCATATGC GTTCAATATA TTTTCTACTT
TCAAATAATG CGCTCTTTGG TGTTTTCTTG GCTTGGACAG AAGGATTCTT TACACATTAA ACGAATTTAC TGGTTTGCTT
GTTCCATGGT CCAGAATCTC AAATGTGTAA ACATTTGATA TGAGCTCAAA ATGAGTTAGC TACTATGGTT TAAACTTCTA
GTAAGTGGTA ACTGATAACA GTCCTTATTT CAGATATAGA GCCCTTTTCA TGTGCTTGCT GATTTGTCAT CTATTCATCT
TTGGTGTTTG GGCTGTTAGC TTGATGATCT AAACTGTTCT TTCTCAAACT GCCTTGTGAC AATGACATTT ATTTTCAGTG
ATGGAGGTTA CTTTAATGCA ATAATGAGCT TTCCACAGAA TTATCCTAAC AGTCCTCCAA CTGTCAGATT TACCTCAGAA
ATGTGGCATC CAAATGGTCA GCTTTCCTCA TTGTAACTTC ATGTTTCTGT AACTCCATGA TCCATAATTT TAACACAGCA
TAATATTGGT CAATTGCCAG TTTATCCGGA TGGACGTGTA TGCATTTCTA TTCTTCATCC GCCTGGTGAT GATCCCAATG
GTTATGAGCT TGCGAGTGAG CGTTGGACAC CAGTGCATAC GGTACGAATT ATGGTGTCTA TGATGCAAGC AATTTCTTCC
CTTTTCATTC TGTTCTGCAC TAGTTCCATT TTGTTGACAA CTTGACATAT ATTCTGCGTG GAGGCCTGGA GGGTATTGTC
TGCTGAATTT TCTTACATAA ATAATCAATA AGCTTTGACA AAGGAAAGAG CTTGTGATGC AAATTTGGGA GTTTGTTAAG
CATCTGCAAT GCAATACACG GGCATAACAC CACACTGCAA ATATTTCCTA AAATTGTGAA CAATGATGAT GGCTTTGTTT
TGCATTTTGG ATATTCATGA TAACTTTTTT GCCTTCCACC TAGAGTTTCG TTTTTGTAAT CCTTTTATCT CTAATATTGT
TACTGTAAAG TGCAATGCGT TATTTTCTTT GGACTAGCAA GTTATTAAAC TTGCATAAGA ATCTTTGTGC ATCTGATATT
ATCTAGTTCA GATAGTAAAT CCTTTCAAAC TTCAAAGTAT AAGAAGCCTT ATATGTAGAG TTGGTGTAAC CTTCGGTAAT
TTATAGTATG ATAGCTTGAA ACATCACTAC AAATTCCATC GTTGACATAT CAAACTCAGC TTCTGGTATA CTGAAAAGTC
AAAAGTAATT GTAGCATTTG AATCTTGCAT TTGAATAATA GTCATATTTT GAACAATGCT GCAAAGTTAC TTGTTTGTTT
TGTCACTGAT CTTGTCATGA TCATATGTTT ATCTTCTCTA GCTTTTTGTA AGTAGCCATT TTTTACTGTC TAATCATCAT
ATTCCTGATT CTTGTAATTT TAATGAGTGT TTTCCATTTA CAGGTTGAGA GCATAGTTCT GAGCATCATT TCGATGCTTT
CTGGTCCAAA TGATGAATCA CCAGCAAATA TTGAAGCAGC TGTAAGTTCA CTTAACATTT GCTATGGAAA TTGAGAACTC
TGTTCCTCCT GGGCCTTGGT GTATATGGCA TTTTATCTGT CACGGAGGGA TGGGGGAAGA GTTGAAGTAC TTGTCAATAG
GGAAAACACA GAGTTGGCAG ATCCTACAAA ATAATCTAAC TTCCAGTCCA AAAACCATTT AACTTTATTA TCAACATTTG
CATACTGGAT TCTGCATGTA CCTTTCATCT TAGATATTCA CCTATTTATT TGGTTAGTTG CAGCCCTGAG AATTTTCTCA
GGTACTGCTA TAGTCCTTGA AACATCTGTG AATTTACACA CCAGACATTT GAATGACTTT TTAAACACAC AGAAAATTGT
AGTCAGGACA ATGCGTAGTG TATTTTGCCT GCTGTTTGGT GGACCTTTGT TCTGAACTTC TGCCTACTGT TCTTGCGCAG
AAGGAATGGA GAGAGAAGAG GGATGACTTC AAGAAAAAGG TTAGGCGCCT TGTAAGGAAA TCACAAGAAA TGCTCTGAAG
AAACCGGCAG TACTGGGGAA AGTTAACCAT ACCACGTCAC ATGTGCATGA TTTGGCTGTC GATTTCCAAA TGTCAGTTGA
CACTAGCAAT TCACTTCTCC CCCTCTGTAC TTCCCATAGT GTGCCTGGTG GTGGTCGCGG TTTCGTCTCC CAGGAAGGCT
GAATAGCACT GGGACATGTT TGTCACCTAT TCTAAAGCTC TGGTTGTATT TGTGTGGCTT GGGCTGTAAA CGTTGAGAAA
CTTTGAAATA CTGCCACTCA TCACAATTTT CGTAACAAAC GTCATATAAG CAGGCACCTG CCTGATCTGC TAGCTGTTGA
ACGTTGAAAC ACAATGTCTG CAAACTGGTT TCAGTCCGTT CTTTGTAATA TGTTCTTATA AATGGAGCAA TACTCGGTGC
TGT

Locus: Os01g0839700

Loading...

Locus: Os01g0839700

Loading...