Os01t0846300-01

Locus

Os01g0846300

Description

Clade A type 2C protein phosphatase (PP2C), Negative regulation of drought tolerance through ABA signaling, Regulation of the trade-off between plant growth and drought tolerance

RAP-DB Gene Symbol Synonym(s)

OsPP2C09

RAP-DB Gene Name Synonym(s)

protein phosphatase 2C09

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPP15, PP15, OsPP2C09, OsPP2C9, PP2C9

Oryzabase Gene Name Synonym(s)

protein phosphatase 15, protein phosphatase 2C09, protein phosphatase 2C9, protein phosphatase 2C 9

Transcript Evidence

AK065949

Protein Evidence

Q5N9N2

Literature

PMID: 32433775

PMID: 19021904

Note

Manual Curation

May 21, 2020

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

PPM-type phosphatase domain superfamily (IPR036457)

PPM-type phosphatase domain (IPR001932)

PPM-type phosphatase, divalent cation binding (IPR000222)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J013046H22 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0846300-01)

RiceXPro (AK065949)

Others

Oryzabase (13612)

KEGG (Os01t0846300-01 (EC:3.1.3.16))

Transcript

1753 bp

>Os01t0846300-01 Clade A type 2C protein phosphatase (PP2C), Negative regulation of drought tolerance through ABA signaling, Regulation of the trade-off between plant growth and drought tolerance
CCTTCTCTTCTACTCCCCCCACCACCCCCGCCTTCGTGCTTGCGTGTCGTCGCCTCACCT
CGCGCCTCCGCTACTACTGCTTGTCTGCTGCTGCAGCTGCTGTTATTACCATACCGCGGG
AGAAGGGGGGCCGAACCCGAAGGCGTGCGAGAGGGAGGTGAGGTGAGGTGGAGCCGTGGA
GGCGCTTGTTTCGCGTGCGAGACGGTGCTTCGTTTCGCCTCACGTTTTCCGAGGGCTACG
GCGACTTGGTGGGAGCGCGGAGAAAATCTAGCGAGCCGTCGGAGTTGGGTGGCGCGCGGC
CGGCTGTGCTTCTGAAGGAGGAGTAATTGGAGTAGTTGCTTGCCATGGCCGAGATCTGCT
GCGAGGAGGCCATGTCGCCGCCGGCCACTGCCACGGCTGCTGTCGCGGCAGCGGTCTCCG
CCTCGGCCGCCGCAGCCGTCTCCTCGGCGATAGACAGGCGGCGCCGCAGGATGGAGATGA
GGCGCATCCGCATCGCAAGTGATCTCGAGCTGCAGGCCGGAGAGGATGGGCGCCCTGGAA
AGCGGCAGAGGCTGGCGCGCACGGCGTCTGGCGCCCCGCGTCCTGACGAGGATTCGGCGT
CTGAGCGGCCGAGTTGTGGCCGTACGGAGGAGTTCCCGAGGTATGGGGTCACCGCTGTGT
GCGGCCGCCGTCGCGAGATGGAAGACGCCGTGTCCATCAGACCGGACTTCTTGCCGGCAT
CCGGCAAGTTCCATTTTTACGGCGTCTTCGACGGCCATGGCTGCTCCCATGTTGCGACGA
CGTGCCAGGACAGGATGCACGAGATTGTCGCCGAGGAGCACAACAAGGGGGCCTCCGGCG
AAGTGGCGCCTTGGAGGGATGTGATGGAGAAGAGCTTCGCGCGGATGGATGGGGAGGTCG
GTAACCGGGCGTCCACCCGCAGCGACGACGAGCCCGCCTGCCCGTGCGAGCAGCAGACGC
CTTCGCGTCGCGACCACGCGGGTTCCACCGCCGTCGTCGCCGTCGTTAGCCCAACACAGG
TCGTCGTCGCCAACGCCGGCGACTCCCGCGCCGTCATCTCCCGTGCCGGCGTCCCCGTCG
CACTATCCGTTGACCACAAACCCGATCGGCCCGACGAGCTGGAACGAATCGAGGCGGCGG
GCGGCCGCGTCATTTACTGGGACGGCGCCCGGGTGCTCGGCGTCCTCGCCATGTCTCGAG
CCATCGGGGATGGGTACCTTAAGCCGTACGTGACGTCGGAGCCGGAGGTGACCGTGACGG
AGCGCACCGACGACGATGAGTGCCTGATCCTGGCCAGCGACGGGCTATGGGACGTCGTGA
CCAACGAGATGGCGTGTGAGGTCGTGAGGGCGTGCTTCCACAACAACGGTCCGCCGGCAC
CGGCCGCGCGGCCGAGCGGCGTGCCCTCCTCGGCCGAGGCGGCGGAAACCGAGAACGGAG
GAGCCGCATCGGTGAAGGGGATAAGCAAGGCGGAGTCCTCCGACAAGGCGTGCTCCGACG
CGGCCATGCTGCTGACGAAGTTGGCGCTGGCGCGGCGGAGCGCGGACAATGTCAGCGTCG
TCGTCGTAGATCTCCGCCGGGGATTGTGATTCTTGGCGCAATATTCTATGCTCCATGATT
GCTTTCTTTCTTCTTCTTTTTTTTATTCTAAGTTAATTTTTCCCTTCAAATTTCTTCCTT
ATTTCTCTGTTTAGTTTTAGTTTTACTACTAGCTCCTACCAAGATAAATGAATATAATAG
CCTTTTTTTTCGC

CDS

1245 bp

>Os01t0846300-01 Clade A type 2C protein phosphatase (PP2C), Negative regulation of drought tolerance through ABA signaling, Regulation of the trade-off between plant growth and drought tolerance
ATGGCCGAGATCTGCTGCGAGGAGGCCATGTCGCCGCCGGCCACTGCCACGGCTGCTGTC
GCGGCAGCGGTCTCCGCCTCGGCCGCCGCAGCCGTCTCCTCGGCGATAGACAGGCGGCGC
CGCAGGATGGAGATGAGGCGCATCCGCATCGCAAGTGATCTCGAGCTGCAGGCCGGAGAG
GATGGGCGCCCTGGAAAGCGGCAGAGGCTGGCGCGCACGGCGTCTGGCGCCCCGCGTCCT
GACGAGGATTCGGCGTCTGAGCGGCCGAGTTGTGGCCGTACGGAGGAGTTCCCGAGGTAT
GGGGTCACCGCTGTGTGCGGCCGCCGTCGCGAGATGGAAGACGCCGTGTCCATCAGACCG
GACTTCTTGCCGGCATCCGGCAAGTTCCATTTTTACGGCGTCTTCGACGGCCATGGCTGC
TCCCATGTTGCGACGACGTGCCAGGACAGGATGCACGAGATTGTCGCCGAGGAGCACAAC
AAGGGGGCCTCCGGCGAAGTGGCGCCTTGGAGGGATGTGATGGAGAAGAGCTTCGCGCGG
ATGGATGGGGAGGTCGGTAACCGGGCGTCCACCCGCAGCGACGACGAGCCCGCCTGCCCG
TGCGAGCAGCAGACGCCTTCGCGTCGCGACCACGCGGGTTCCACCGCCGTCGTCGCCGTC
GTTAGCCCAACACAGGTCGTCGTCGCCAACGCCGGCGACTCCCGCGCCGTCATCTCCCGT
GCCGGCGTCCCCGTCGCACTATCCGTTGACCACAAACCCGATCGGCCCGACGAGCTGGAA
CGAATCGAGGCGGCGGGCGGCCGCGTCATTTACTGGGACGGCGCCCGGGTGCTCGGCGTC
CTCGCCATGTCTCGAGCCATCGGGGATGGGTACCTTAAGCCGTACGTGACGTCGGAGCCG
GAGGTGACCGTGACGGAGCGCACCGACGACGATGAGTGCCTGATCCTGGCCAGCGACGGG
CTATGGGACGTCGTGACCAACGAGATGGCGTGTGAGGTCGTGAGGGCGTGCTTCCACAAC
AACGGTCCGCCGGCACCGGCCGCGCGGCCGAGCGGCGTGCCCTCCTCGGCCGAGGCGGCG
GAAACCGAGAACGGAGGAGCCGCATCGGTGAAGGGGATAAGCAAGGCGGAGTCCTCCGAC
AAGGCGTGCTCCGACGCGGCCATGCTGCTGACGAAGTTGGCGCTGGCGCGGCGGAGCGCG
GACAATGTCAGCGTCGTCGTCGTAGATCTCCGCCGGGGATTGTGA

Protein

415 aa

>Os01t0846300-01 Clade A type 2C protein phosphatase (PP2C), Negative regulation of drought tolerance through ABA signaling, Regulation of the trade-off between plant growth and drought tolerance
MAEICCEEAMSPPATATAAVAAAVSASAAAAVSSAIDRRRRRMEMRRIRIASDLELQAGE
DGRPGKRQRLARTASGAPRPDEDSASERPSCGRTEEFPRYGVTAVCGRRREMEDAVSIRP
DFLPASGKFHFYGVFDGHGCSHVATTCQDRMHEIVAEEHNKGASGEVAPWRDVMEKSFAR
MDGEVGNRASTRSDDEPACPCEQQTPSRRDHAGSTAVVAVVSPTQVVVANAGDSRAVISR
AGVPVALSVDHKPDRPDELERIEAAGGRVIYWDGARVLGVLAMSRAIGDGYLKPYVTSEP
EVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACFHNNGPPAPAARPSGVPSSAEAA
ETENGGAASVKGISKAESSDKACSDAAMLLTKLALARRSADNVSVVVVDLRRGL*

5'UTR

chr01:36343948..36344291 (+ strand) : 344 bp

CDS

chr01:36344292..36344717 (+ strand) : 426 bp

chr01:36344809..36345138 (+ strand) : 330 bp

chr01:36345264..36345369 (+ strand) : 106 bp

chr01:36345463..36345845 (+ strand) : 383 bp

3'UTR

chr01:36345846..36346009 (+ strand) : 164 bp

FASTA

>Os01t0846300-01 class=Sequence position=chr01:36343948..36346009 (+ strand)
CCTTCTCTTC TACTCCCCCC ACCACCCCCG CCTTCGTGCT TGCGTGTCGT CGCCTCACCT CGCGCCTCCG CTACTACTGC
TTGTCTGCTG CTGCAGCTGC TGTTATTACC ATACCGCGGG AGAAGGGGGG CCGAACCCGA AGGCGTGCGA GAGGGAGGTG
AGGTGAGGTG GAGCCGTGGA GGCGCTTGTT TCGCGTGCGA GACGGTGCTT CGTTTCGCCT CACGTTTTCC GAGGGCTACG
GCGACTTGGT GGGAGCGCGG AGAAAATCTA GCGAGCCGTC GGAGTTGGGT GGCGCGCGGC CGGCTGTGCT TCTGAAGGAG
GAGTAATTGG AGTAGTTGCT TGCCATGGCC GAGATCTGCT GCGAGGAGGC CATGTCGCCG CCGGCCACTG CCACGGCTGC
TGTCGCGGCA GCGGTCTCCG CCTCGGCCGC CGCAGCCGTC TCCTCGGCGA TAGACAGGCG GCGCCGCAGG ATGGAGATGA
GGCGCATCCG CATCGCAAGT GATCTCGAGC TGCAGGCCGG AGAGGATGGG CGCCCTGGAA AGCGGCAGAG GCTGGCGCGC
ACGGCGTCTG GCGCCCCGCG TCCTGACGAG GATTCGGCGT CTGAGCGGCC GAGTTGTGGC CGTACGGAGG AGTTCCCGAG
GTATGGGGTC ACCGCTGTGT GCGGCCGCCG TCGCGAGATG GAAGACGCCG TGTCCATCAG ACCGGACTTC TTGCCGGCAT
CCGGCAAGTT CCATTTTTAC GGCGTCTTCG ACGGCCATGG CTGCTCCCAT GTAAGTGTTT GCTGATGTCT AAATGTGCGA
ACCGGATAGT GATCTGTGCA CATGTAATTC AGCGTGCTAA TTCGAGTTCT ATGAATATTA GGTTGCGACG ACGTGCCAGG
ACAGGATGCA CGAGATTGTC GCCGAGGAGC ACAACAAGGG GGCCTCCGGC GAAGTGGCGC CTTGGAGGGA TGTGATGGAG
AAGAGCTTCG CGCGGATGGA TGGGGAGGTC GGTAACCGGG CGTCCACCCG CAGCGACGAC GAGCCCGCCT GCCCGTGCGA
GCAGCAGACG CCTTCGCGTC GCGACCACGC GGGTTCCACC GCCGTCGTCG CCGTCGTTAG CCCAACACAG GTCGTCGTCG
CCAACGCCGG CGACTCCCGC GCCGTCATCT CCCGTGCCGG CGTCCCCGTC GCACTATCCG TTGACCACAA AGTACGTATA
TGCTCGCATC ACAGGGCCGG CTGAGCCTTT CCCGTCCATC TGCAAAAAAT CGTTAGTTTC TTGTCCATGA GCGTGTGCCT
GACATGGTTG CTACTTGCTA CCTCGGAACG GTTCAGCCCG ATCGGCCCGA CGAGCTGGAA CGAATCGAGG CGGCGGGCGG
CCGCGTCATT TACTGGGACG GCGCCCGGGT GCTCGGCGTC CTCGCCATGT CTCGAGCCAT CGGTGAGCTG ATCTAGTTTT
ACCTTCTTCT CTCGTCGTCT CAAGAATTTT GATTTGGCAC CCGGATCCGA AACTCACCTG CGTATGGGCG CGCAGGGGAT
GGGTACCTTA AGCCGTACGT GACGTCGGAG CCGGAGGTGA CCGTGACGGA GCGCACCGAC GACGATGAGT GCCTGATCCT
GGCCAGCGAC GGGCTATGGG ACGTCGTGAC CAACGAGATG GCGTGTGAGG TCGTGAGGGC GTGCTTCCAC AACAACGGTC
CGCCGGCACC GGCCGCGCGG CCGAGCGGCG TGCCCTCCTC GGCCGAGGCG GCGGAAACCG AGAACGGAGG AGCCGCATCG
GTGAAGGGGA TAAGCAAGGC GGAGTCCTCC GACAAGGCGT GCTCCGACGC GGCCATGCTG CTGACGAAGT TGGCGCTGGC
GCGGCGGAGC GCGGACAATG TCAGCGTCGT CGTCGTAGAT CTCCGCCGGG GATTGTGATT CTTGGCGCAA TATTCTATGC
TCCATGATTG CTTTCTTTCT TCTTCTTTTT TTTATTCTAA GTTAATTTTT CCCTTCAAAT TTCTTCCTTA TTTCTCTGTT
TAGTTTTAGT TTTACTACTA GCTCCTACCA AGATAAATGA ATATAATAGC CTTTTTTTTC GC

Locus: Os01g0846300

Loading...

Locus: Os01g0846300

Loading...