Os01t0846300-02

Locus

Os01g0846300

Description

Similar to protein phosphatase 2C.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPP15, PP15, OsPP2C09, OsPP2C9, PP2C9

Oryzabase Gene Name Synonym(s)

protein phosphatase 15, protein phosphatase 2C09, protein phosphatase 2C9, protein phosphatase 2C 9

Transcript Evidence

AK071996 (DDBJ, Best hit)

Protein Evidence

B9EUE1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein dephosphorylation (GO:0006470)

Cellular Component: protein serine/threonine phosphatase complex (GO:0008287)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein serine/threonine phosphatase activity (GO:0004722)

Functional domain (InterPro)

Protein phosphatase 2C, manganese/magnesium aspartate binding site (IPR000222)

Protein phosphatase 2C-like (IPR001932)

Protein phosphatase 2C (IPR015655)

Full-length cDNA

J013091F23 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0846300-02)

RiceXPro (AK071996)

Others

Oryzabase (13612)

KEGG (Os01t0846300-02)

Transcript

1833 bp

>Os01t0846300-02 Similar to protein phosphatase 2C.
GTCGTCGCCTCACCTCGCGCCTCCGCTACTACTGCTTGTCTGCTGCTGCAGCTGCTGTTA
TTACCATACCGCGGGAGAAGGGGGGCCGAACCCGAAGGCGTGCGAGAGGGAGGTGAGGTG
AGGTGGAGCCGTGGAGGCGCTTGTTTCGCGTGCGAGACGGTGCTTCGTTTCGCCTCACGT
TTTCCGAGGGCTACGGCGACTTGGTGGGAGCGCGGAGAAAATCTAGCGAGCCGTCGGAGT
TGGGTGGCGCGCGGCCGGCTGTGCTTCTGAAGGAGGAGTAATTGGAGTAGTTGCTTGCCA
TGGCCGAGATCTGCTGCGAGGAGGCCATGTCGCCGCCGGCCACTGCCACGGCTGCTGTCG
CGGCAGCGGTCTCCGCCTCGGCCGCCGCAGCCGTCTCCTCGGCGATAGACAGGCGGCGCC
GCAGGATGGAGATGAGGCGCATCCGCATCGCAAGTGATCTCGAGCTGCAGGCCGGAGAGG
ATGGGCGCCCTGGAAAGCGGCAGAGGCTGGCGCGCACGGCGTCTGGCGCCCCGCGTCCTG
ACGAGGATTCGGCGTCTGAGCGGCCGAGTTGTGGCCGTACGGAGGAGTTCCCGAGGTATG
GGGTCACCGCTGTGTGCGGCCGCCGTCGCGAGATGGAAGACGCCGTGTCCATCAGACCGG
ACTTCTTGCCGGCATCCGGCAAGTTCCATTTTTACGGCGTCTTCGACGGCCATGGCTGCT
CCCATGTTGCGACGACGTGCCAGGACAGGATGCACGAGATTGTCGCCGAGGAGCACAACA
AGGGGGCCTCCGGCGAAGTGGCGCCTTGGAGGGATGTGATGGAGAAGAGCTTCGCGCGGA
TGGATGGGGAGGTCGGTAACCGGGCGTCCACCCGCAGCGACGACGAGCCCGCCTGCCCGT
GCGAGCAGCAGACGCCTTCGCGTCGCGACCACGCGGGTTCCACCGCCGTCGTCGCCGTCG
TTAGCCCAACACAGGTCGTCGTCGCCAACGCCGGCGACTCCCGCGCCGTCATCTCCCGTG
CCGGCGTCCCCGTCGCACTATCCGTTGACCACAAAGTACGTATATGCTCGCATCACAGGG
CCGGCTGAGCCTTTCCCGTCCATCTGCAAAAAATCGTTAGTTTCTTGTCCATGAGCGTGT
GCCTGACATGGTTGCTACTTGCTACCTCGGAACGGTTCAGCCCGATCGGCCCGACGAGCT
GGAACGAATCGAGGCGGCGGGCGGCCGCGTCATTTACTGGGACGGCGCCCGGGTGCTCGG
CGTCCTCGCCATGTCTCGAGCCATCGGGGATGGGTACCTTAAGCCGTACGTGACGTCGGA
GCCGGAGGTGACCGTGACGGAGCGCACCGACGACGATGAGTGCCTGATCCTGGCCAGCGA
CGGGCTATGGGACGTCGTGACCAACGAGATGGCGTGTGAGGTCGTGAGGGCGTGCTTCCA
CAACAACGGTCCGCCGGCACCGGCCGCGCGGCCGAGCGGCGTGCCCTCCTCGGCCGAGGC
GGCGGAAACCGAGAACGGAGGAGCCGCATCGGTGAAGGGGATAAGCAAGGCGGAGTCCTC
CGACAAGGCGTGCTCCGACGCGGCCATGCTGCTGACGAAGTTGGCGCTGGCGCGGCGGAG
CGCGGACAATGTCAGCGTCGTCGTCGTAGATCTCCGCCGGGGATTGTGATTCTTGGCGCA
ATATTCTATGCTCCATGATTGCTTTCTTTCTTCTTCTTTTTTTTATTCTAAGTTAATTTT
TCCCTTCAAATTTCTTCCTTATTTCTCTGTTTAGTTTTAGTTTTACTACTAGCTCCTACC
AAGATAAATGAATATAATAGCCTTTTTTTTCGC

CDS

789 bp

>Os01t0846300-02 Similar to protein phosphatase 2C.
ATGGCCGAGATCTGCTGCGAGGAGGCCATGTCGCCGCCGGCCACTGCCACGGCTGCTGTC
GCGGCAGCGGTCTCCGCCTCGGCCGCCGCAGCCGTCTCCTCGGCGATAGACAGGCGGCGC
CGCAGGATGGAGATGAGGCGCATCCGCATCGCAAGTGATCTCGAGCTGCAGGCCGGAGAG
GATGGGCGCCCTGGAAAGCGGCAGAGGCTGGCGCGCACGGCGTCTGGCGCCCCGCGTCCT
GACGAGGATTCGGCGTCTGAGCGGCCGAGTTGTGGCCGTACGGAGGAGTTCCCGAGGTAT
GGGGTCACCGCTGTGTGCGGCCGCCGTCGCGAGATGGAAGACGCCGTGTCCATCAGACCG
GACTTCTTGCCGGCATCCGGCAAGTTCCATTTTTACGGCGTCTTCGACGGCCATGGCTGC
TCCCATGTTGCGACGACGTGCCAGGACAGGATGCACGAGATTGTCGCCGAGGAGCACAAC
AAGGGGGCCTCCGGCGAAGTGGCGCCTTGGAGGGATGTGATGGAGAAGAGCTTCGCGCGG
ATGGATGGGGAGGTCGGTAACCGGGCGTCCACCCGCAGCGACGACGAGCCCGCCTGCCCG
TGCGAGCAGCAGACGCCTTCGCGTCGCGACCACGCGGGTTCCACCGCCGTCGTCGCCGTC
GTTAGCCCAACACAGGTCGTCGTCGCCAACGCCGGCGACTCCCGCGCCGTCATCTCCCGT
GCCGGCGTCCCCGTCGCACTATCCGTTGACCACAAAGTACGTATATGCTCGCATCACAGG
GCCGGCTGA

Protein

263 aa

>Os01t0846300-02 Similar to protein phosphatase 2C.
MAEICCEEAMSPPATATAAVAAAVSASAAAAVSSAIDRRRRRMEMRRIRIASDLELQAGE
DGRPGKRQRLARTASGAPRPDEDSASERPSCGRTEEFPRYGVTAVCGRRREMEDAVSIRP
DFLPASGKFHFYGVFDGHGCSHVATTCQDRMHEIVAEEHNKGASGEVAPWRDVMEKSFAR
MDGEVGNRASTRSDDEPACPCEQQTPSRRDHAGSTAVVAVVSPTQVVVANAGDSRAVISR
AGVPVALSVDHKVRICSHHRAG*

5'UTR

chr01:36343993..36344291 (+ strand) : 299 bp

CDS

chr01:36344292..36344717 (+ strand) : 426 bp

chr01:36344809..36345171 (+ strand) : 363 bp

3'UTR

chr01:36345172..36345369 (+ strand) : 198 bp

chr01:36345463..36346009 (+ strand) : 547 bp

FASTA

>Os01t0846300-02 class=Sequence position=chr01:36343993..36346009 (+ strand)
GTCGTCGCCT CACCTCGCGC CTCCGCTACT ACTGCTTGTC TGCTGCTGCA GCTGCTGTTA TTACCATACC GCGGGAGAAG
GGGGGCCGAA CCCGAAGGCG TGCGAGAGGG AGGTGAGGTG AGGTGGAGCC GTGGAGGCGC TTGTTTCGCG TGCGAGACGG
TGCTTCGTTT CGCCTCACGT TTTCCGAGGG CTACGGCGAC TTGGTGGGAG CGCGGAGAAA ATCTAGCGAG CCGTCGGAGT
TGGGTGGCGC GCGGCCGGCT GTGCTTCTGA AGGAGGAGTA ATTGGAGTAG TTGCTTGCCA TGGCCGAGAT CTGCTGCGAG
GAGGCCATGT CGCCGCCGGC CACTGCCACG GCTGCTGTCG CGGCAGCGGT CTCCGCCTCG GCCGCCGCAG CCGTCTCCTC
GGCGATAGAC AGGCGGCGCC GCAGGATGGA GATGAGGCGC ATCCGCATCG CAAGTGATCT CGAGCTGCAG GCCGGAGAGG
ATGGGCGCCC TGGAAAGCGG CAGAGGCTGG CGCGCACGGC GTCTGGCGCC CCGCGTCCTG ACGAGGATTC GGCGTCTGAG
CGGCCGAGTT GTGGCCGTAC GGAGGAGTTC CCGAGGTATG GGGTCACCGC TGTGTGCGGC CGCCGTCGCG AGATGGAAGA
CGCCGTGTCC ATCAGACCGG ACTTCTTGCC GGCATCCGGC AAGTTCCATT TTTACGGCGT CTTCGACGGC CATGGCTGCT
CCCATGTAAG TGTTTGCTGA TGTCTAAATG TGCGAACCGG ATAGTGATCT GTGCACATGT AATTCAGCGT GCTAATTCGA
GTTCTATGAA TATTAGGTTG CGACGACGTG CCAGGACAGG ATGCACGAGA TTGTCGCCGA GGAGCACAAC AAGGGGGCCT
CCGGCGAAGT GGCGCCTTGG AGGGATGTGA TGGAGAAGAG CTTCGCGCGG ATGGATGGGG AGGTCGGTAA CCGGGCGTCC
ACCCGCAGCG ACGACGAGCC CGCCTGCCCG TGCGAGCAGC AGACGCCTTC GCGTCGCGAC CACGCGGGTT CCACCGCCGT
CGTCGCCGTC GTTAGCCCAA CACAGGTCGT CGTCGCCAAC GCCGGCGACT CCCGCGCCGT CATCTCCCGT GCCGGCGTCC
CCGTCGCACT ATCCGTTGAC CACAAAGTAC GTATATGCTC GCATCACAGG GCCGGCTGAG CCTTTCCCGT CCATCTGCAA
AAAATCGTTA GTTTCTTGTC CATGAGCGTG TGCCTGACAT GGTTGCTACT TGCTACCTCG GAACGGTTCA GCCCGATCGG
CCCGACGAGC TGGAACGAAT CGAGGCGGCG GGCGGCCGCG TCATTTACTG GGACGGCGCC CGGGTGCTCG GCGTCCTCGC
CATGTCTCGA GCCATCGGTG AGCTGATCTA GTTTTACCTT CTTCTCTCGT CGTCTCAAGA ATTTTGATTT GGCACCCGGA
TCCGAAACTC ACCTGCGTAT GGGCGCGCAG GGGATGGGTA CCTTAAGCCG TACGTGACGT CGGAGCCGGA GGTGACCGTG
ACGGAGCGCA CCGACGACGA TGAGTGCCTG ATCCTGGCCA GCGACGGGCT ATGGGACGTC GTGACCAACG AGATGGCGTG
TGAGGTCGTG AGGGCGTGCT TCCACAACAA CGGTCCGCCG GCACCGGCCG CGCGGCCGAG CGGCGTGCCC TCCTCGGCCG
AGGCGGCGGA AACCGAGAAC GGAGGAGCCG CATCGGTGAA GGGGATAAGC AAGGCGGAGT CCTCCGACAA GGCGTGCTCC
GACGCGGCCA TGCTGCTGAC GAAGTTGGCG CTGGCGCGGC GGAGCGCGGA CAATGTCAGC GTCGTCGTCG TAGATCTCCG
CCGGGGATTG TGATTCTTGG CGCAATATTC TATGCTCCAT GATTGCTTTC TTTCTTCTTC TTTTTTTTAT TCTAAGTTAA
TTTTTCCCTT CAAATTTCTT CCTTATTTCT CTGTTTAGTT TTAGTTTTAC TACTAGCTCC TACCAAGATA AATGAATATA
ATAGCCTTTT TTTTCGC

Locus: Os01g0846300

Loading...

Locus: Os01g0846300

Loading...