Os01t0846450-02

Locus

Os01g0846450

Description

Homolog of Arabidopsis thaliana HEN1 suppressor 1, Heading date

RAP-DB Gene Symbol Synonym(s)

HESO1

RAP-DB Gene Name Synonym(s)

a homolog of Arabidopsis thaliana HEN1 suppressor 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

a homolog of Arabidopsis thaliana HEN1 suppressor 1, HESO1 homolog

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 27322545

Note

Manual Curation

August 30, 2017

Others

Oryzabase (21339)

Transcript

2306 bp

>Os01t0846450-02 Homolog of Arabidopsis thaliana HEN1 suppressor 1, Heading date
GTTTTTACTTGCTTCCCCCATCGGTCTCCCTCTGGCGCGCCGCTTTGGCTTTTCCGAAAG
GAAGCCAGTCATCCATCTCCCCCGATTTAACCCGACGCCGTGCCGCTAGTCTGATCCGCC
ACCGCCACGGTCTCCTCCTCGCCCCCGTGCCTCCGCCTCCTCCTCCTCCCGTCCAGCCCG
TATCGACGAGACCAGCAAGGCGCCGCCGCGCGCGGAGCTCTCGACGCCCGCCGACGACCC
GCCCGCCGTCAGATCCGCCTGCTGCATGCTTCCTCCAGGATTTCAGTATGACTGAACATA
TAAATTATGATGTGGTGGAGCAGTGTGTTAAAAACATCCTCTCTCTAATCAAACCAGTGG
AGGATGACAGACGCAAACGACTATCTGCAATTCAGGAGTTATCAAATTCCATTCCTAAAG
TTGCAGCCTTAAGAGGTGCTGTTTTCAAACCTTTTGGATCCTTTGTATCAAATCTTTACT
CAAATTCAGGTGATTTGGATATATCGGTTCACCTCCCTAATAACTCAATCATAAGCAAGA
AGAAAAAGCAATATGTCTTGAGGGAATTAATGAGAGTGCTACAAAATAGAGGTGTTGCCG
GATATGTGCAATTTGTTCCTTTTGCAAGAGTTCCAGTTCTTCAGTATGTGAGCAACACCT
TCGGAATTTCCTGCGATATATCTGTGAACAACTACCCTGGTCGAATTAAATCCAAAATCT
TCTGCTGGATCAGTTCTTTAGATGTGCGTTTTGGTGATATGGTTTTACTGATCAAAGAAT
GGGCGAAAGCTCAAAACATTAATGATCCCAAAACTGGGACCTTAAACTCCTATTCACTTT
GCCTACTAGTCCTCTTCCATTTTCAGACATGTGAGCCTGCAATCCTTCCACCTCTTAAGG
AGATTTATGAAGGGAACATTGAAGAAGAAATGACGGTGTATGATGAGGAACATCTTGATG
AGGTTTGCTCTGAAAATTTAGCAAAATTTCAAAGCAAGAACAAGGAACGAAGGAATGAAA
GCTCTCTTTGCCATCTGCTTGCAACCTTTTTCCACAAATTTTCCTCTATCGGCACCCTTT
CGGGTGATGTGATATCCACTTACACGGGCCAGTTCAAACGAATAGAGGAGAACCCAAGTT
GGATGGCCAGATCATACAGCTTATTTGTCAAAGATCCAATTGAGAGACCTGATAATGCCG
CTAGAGCGGTTGATTTGAAAGGCCTTGAGCGGATTGCTGGGGCCTTCACCGCTGCTAATC
GTAAGTTTGCATCTCTCCAACACGCCAAACGAAATGACTTACTGGAGATGCTGTGTACGC
CTGCTGTTGGCTCAAAGCTTGGCATAAGAGTTAGCCAAGAAGTTATGGCTAACTCTTGCA
CAAATACTCCACGGAGGAACCGTCATCATGGTAGACCAACGGAACAAGTCTCAGCGAGGC
CATCTGATAATCAAAATCACCGCGGGGCCAGAGAATTTACAGTTGGGAGACAAGTTCATA
ATCCCCCACGGGCGCGCCAATCAACTGGAGCGTACCATGCTCTTAACAGTCAGCATGTAA
TTCCTGCATTGAGCCAACCAGCAGGAATTTATCAAACAGTTGGCCCATACCAGAGTAATG
GTCATCCACAGGTGTATACTAGAGATGTCCAAACAGTAGGGCACCAAAATTATAGGCATC
CAATGGGACACAACACACAGCTCCAAACAGTGGAACCATATCAGAGTAATAATAGTCAAC
CACAGGTTCATGCTACCAGCATCCAAGCACCAAGACAATACCAGAATTATACTCGATAAC
GCCCGGCCAGAAACTACAATCACCAAGTGTTACATGCTACAGCGACCGAGACAACGGCCA
GAAACTACAATCACCAATTGTTACATGCTGCAGCAACCGAGACAACGGCCAGAAACTATA
ATCACCAATCGTTACATGCTACAGCAACCGAGACAGAAGGATCATACCGGAATCAGCAGC
AGAGACAACACACATCTGGCCGTCAAACAAATAGGAACGCTGTGAACACAAGGTACGTGC
CTGTTGTTGGAAGGCCACAAAATGTAGCATGTGAATCACGAGCTCAAGACTCCTCAGGCA
GGGGAACATGGCAACAAAGGGAGCCGCGAGCAGGATCAACCTACCAAAATAGATAGCAAC
GGATTATCTTCAGCTTTTGCATCGCAGTGTGTATGAGTTTTTGGTAGTTTGTGATAGCTT
TCGTCAGCCAGCAGTTTGATCTCAGTGCCGCTGCAATGCAGCGAACTGTATTGGGTAAAA
TGCAGTTACAAGATTTTCTTTTGTGC

CDS

1512 bp

>Os01t0846450-02 Homolog of Arabidopsis thaliana HEN1 suppressor 1, Heading date
ATGACTGAACATATAAATTATGATGTGGTGGAGCAGTGTGTTAAAAACATCCTCTCTCTA
ATCAAACCAGTGGAGGATGACAGACGCAAACGACTATCTGCAATTCAGGAGTTATCAAAT
TCCATTCCTAAAGTTGCAGCCTTAAGAGGTGCTGTTTTCAAACCTTTTGGATCCTTTGTA
TCAAATCTTTACTCAAATTCAGGTGATTTGGATATATCGGTTCACCTCCCTAATAACTCA
ATCATAAGCAAGAAGAAAAAGCAATATGTCTTGAGGGAATTAATGAGAGTGCTACAAAAT
AGAGGTGTTGCCGGATATGTGCAATTTGTTCCTTTTGCAAGAGTTCCAGTTCTTCAGTAT
GTGAGCAACACCTTCGGAATTTCCTGCGATATATCTGTGAACAACTACCCTGGTCGAATT
AAATCCAAAATCTTCTGCTGGATCAGTTCTTTAGATGTGCGTTTTGGTGATATGGTTTTA
CTGATCAAAGAATGGGCGAAAGCTCAAAACATTAATGATCCCAAAACTGGGACCTTAAAC
TCCTATTCACTTTGCCTACTAGTCCTCTTCCATTTTCAGACATGTGAGCCTGCAATCCTT
CCACCTCTTAAGGAGATTTATGAAGGGAACATTGAAGAAGAAATGACGGTGTATGATGAG
GAACATCTTGATGAGGTTTGCTCTGAAAATTTAGCAAAATTTCAAAGCAAGAACAAGGAA
CGAAGGAATGAAAGCTCTCTTTGCCATCTGCTTGCAACCTTTTTCCACAAATTTTCCTCT
ATCGGCACCCTTTCGGGTGATGTGATATCCACTTACACGGGCCAGTTCAAACGAATAGAG
GAGAACCCAAGTTGGATGGCCAGATCATACAGCTTATTTGTCAAAGATCCAATTGAGAGA
CCTGATAATGCCGCTAGAGCGGTTGATTTGAAAGGCCTTGAGCGGATTGCTGGGGCCTTC
ACCGCTGCTAATCGTAAGTTTGCATCTCTCCAACACGCCAAACGAAATGACTTACTGGAG
ATGCTGTGTACGCCTGCTGTTGGCTCAAAGCTTGGCATAAGAGTTAGCCAAGAAGTTATG
GCTAACTCTTGCACAAATACTCCACGGAGGAACCGTCATCATGGTAGACCAACGGAACAA
GTCTCAGCGAGGCCATCTGATAATCAAAATCACCGCGGGGCCAGAGAATTTACAGTTGGG
AGACAAGTTCATAATCCCCCACGGGCGCGCCAATCAACTGGAGCGTACCATGCTCTTAAC
AGTCAGCATGTAATTCCTGCATTGAGCCAACCAGCAGGAATTTATCAAACAGTTGGCCCA
TACCAGAGTAATGGTCATCCACAGGTGTATACTAGAGATGTCCAAACAGTAGGGCACCAA
AATTATAGGCATCCAATGGGACACAACACACAGCTCCAAACAGTGGAACCATATCAGAGT
AATAATAGTCAACCACAGGTTCATGCTACCAGCATCCAAGCACCAAGACAATACCAGAAT
TATACTCGATAA

Protein

504 aa

>Os01t0846450-02 Homolog of Arabidopsis thaliana HEN1 suppressor 1, Heading date
MTEHINYDVVEQCVKNILSLIKPVEDDRRKRLSAIQELSNSIPKVAALRGAVFKPFGSFV
SNLYSNSGDLDISVHLPNNSIISKKKKQYVLRELMRVLQNRGVAGYVQFVPFARVPVLQY
VSNTFGISCDISVNNYPGRIKSKIFCWISSLDVRFGDMVLLIKEWAKAQNINDPKTGTLN
SYSLCLLVLFHFQTCEPAILPPLKEIYEGNIEEEMTVYDEEHLDEVCSENLAKFQSKNKE
RRNESSLCHLLATFFHKFSSIGTLSGDVISTYTGQFKRIEENPSWMARSYSLFVKDPIER
PDNAARAVDLKGLERIAGAFTAANRKFASLQHAKRNDLLEMLCTPAVGSKLGIRVSQEVM
ANSCTNTPRRNRHHGRPTEQVSARPSDNQNHRGAREFTVGRQVHNPPRARQSTGAYHALN
SQHVIPALSQPAGIYQTVGPYQSNGHPQVYTRDVQTVGHQNYRHPMGHNTQLQTVEPYQS
NNSQPQVHATSIQAPRQYQNYTR*

5'UTR

chr01:36353072..36353349 (+ strand) : 278 bp

chr01:36354474..36354482 (+ strand) : 9 bp

CDS

chr01:36354483..36354630 (+ strand) : 148 bp

chr01:36355350..36355505 (+ strand) : 156 bp

chr01:36355824..36356002 (+ strand) : 179 bp

chr01:36356088..36356183 (+ strand) : 96 bp

chr01:36356266..36356326 (+ strand) : 61 bp

chr01:36356412..36356542 (+ strand) : 131 bp

chr01:36357193..36357300 (+ strand) : 108 bp

chr01:36357395..36358027 (+ strand) : 633 bp

3'UTR

chr01:36358028..36358534 (+ strand) : 507 bp

FASTA

>Os01t0846450-02 class=Sequence position=chr01:36353072..36358534 (+ strand)
GTTTTTACTT GCTTCCCCCA TCGGTCTCCC TCTGGCGCGC CGCTTTGGCT TTTCCGAAAG GAAGCCAGTC ATCCATCTCC
CCCGATTTAA CCCGACGCCG TGCCGCTAGT CTGATCCGCC ACCGCCACGG TCTCCTCCTC GCCCCCGTGC CTCCGCCTCC
TCCTCCTCCC GTCCAGCCCG TATCGACGAG ACCAGCAAGG CGCCGCCGCG CGCGGAGCTC TCGACGCCCG CCGACGACCC
GCCCGCCGTC AGATCCGCCT GCTGCATGCT TCCTCCAGGT TTAGATCGTT TCCAAAAATC CTCTGCTTCT CTTCAGTAAT
TCCACCCGCG TACGGGGTTT CTCGATCAGA GCGGGGGTTC CGTTTATGAT CGGGTCAGGG TTTACCTATT CCTTGTGATT
TGGGCGGCAT GCGATTTTTG GATTATAGGT GACGTTTGGA GGATATGTAA TATTATGGGT TTTCAGGAAA TCGTTTGGAT
GCTGTAGTTA CCAACCACCG CAGCATGCCT AGCAATTTGT GCAATTACTC GTTACTCTTA ACAGCACTCA CGCTGTCACG
CGCGGTGTGG CACACTGTCA AAATTTGAGA TACGTTGACA CTTCATCATT GGTGGAATCT CGTGAAGGAA TTATTTCAGC
GGATGTGCAT ATGCTATAGT ATGAGAACAT CTATGGTATT ATGTAGATAC AACAATCACT AACCAGTCAC GAGAAGAAGG
TTTTTAGTTG TGATTCTATA ATATATTTGA GAATCAAAAC TAACTTTACA AGCTTATGTG GGTTTGACCC TTCAAAATTT
CTTGGAGTTT TTTATAGTTC AACAAGCGTC AATGATTGCG ATTCATATAT ATACATTGTT TACTAGTAAT GGTTTGTGTG
AGTTCTTGAG ACAAAAATAT GTGGTTGACC ACGCACCAAA TGCATTGTTC CACCACTGCT TTTGGTTGTG ATCATTTTCG
CATAGATAGC GTCATGTCAT GCTGCATTTT GATGGTGATG TTGTGATTCG TGAATGCAAG CAAAATAAAC GCAATGGAAA
CATTTTTTTT GCAAGTCATA TTTTTTGTTT GTTTCTAGTT CTCATCGTTA TCTTCTTTTA ATAAATGTGT CCCTTTGTTC
TCTTAGAGCA TTTTCCCCTC TCAGAAAATT GGAAACATTT AATAAGCATC AGAGTGATCA ATCTTAGTGA ATACTTAATA
GAGAACATAA TTCCATCAAT GTTCTGTTCA GAGCAAATTT GTAGAAAAGA AAACCAGGCA AGCATTGACC TTCTGACTTG
TGGTTAGAAA AATTATCTGG TTGAATCTCC ATTCTCTTTG TTTTTAACAG TATTTTTATT TGTACCCATG TAACATCTTG
TTTTTCCTTT TTGGTCCATT ATATTTCGTT GTTGAACTGC AGGATTTCAG TATGACTGAA CATATAAATT ATGATGTGGT
GGAGCAGTGT GTTAAAAACA TCCTCTCTCT AATCAAACCA GTGGAGGATG ACAGACGCAA ACGACTATCT GCAATTCAGG
AGTTATCAAA TTCCATTCCT AAAGTTGCAG CCTTAAGAGG TGAGTTATCT CATATTTGAT AATTTTTAAG TTTGTAACAA
TGTAATTTTT GATAAGCTAA ATATGAAATG CAATGGCCAC TGTGGACAGT TATGGTCAGT TATCCTTTTG GCACCTACAG
CTGAGGCCCT TGGTCACTTC TCTTGTGATT TGTTGCTAGA ATGGTGGGAA CGGGCAACAA GTAGAATATC TAAGAAACAA
TGTCTTCCAG TGATAGCAGA TAGGCCTGCA GGCTGCAGAA GGTGGTCACA AGTTGTCGGC GAATACAGAT CTAGGCGACT
TAAGTTTAGT CTCACGCATT GCATTCTTTT CAGTAGCTGT CAGTTTCGTA TTAGGGAGAA TCCTCCAGTT GTTTGTTGCC
TTTTTTTTCC TTTTTGCTTC TAATTATCTG CATCATTTGA TCTCTCAAGC CTTTTTGCAT GCTGCTAAAA AGAAAATAAA
GGCAATGGTG ACCAGTGTTC AGTTTATTTT TTCACTACAG TCCTAATGCT GCATAATGTG GAACTATTAG GTGTTTGTTT
TGCTATAATG GGGTCATGAT CTCTTCAAAT GGTATAGATT GTTCAATAAC TTATTTTCCT TCATATACTT GCTTAGTCAA
TGCACAGGTT CTCTAATAAG TTTCCATGAT GGCAAAATGA AATGTCAAAG GATTTAATGA TGATATGATG GTGGTGATTT
AGTGTTGCCT TATCTGAACT TTTAAATTTC TTTAACAGGT GCTGTTTTCA AACCTTTTGG ATCCTTTGTA TCAAATCTTT
ACTCAAATTC AGGTGATTTG GATATATCGG TTCACCTCCC TAATAACTCA ATCATAAGCA AGAAGAAAAA GCAATATGTC
TTGAGGGAAT TAATGAGAGT GCTACAAAAT AGAGGTAAAC CTTTTTTACC ATATTACATA ATAAAGGAGC ATGCAGACTT
CTTCTCATTG CATGATCATT GTACCCATGA AATAATAACC ATGGCTTTTG CGGTAAAACC ATAAAAGGAT TCCATATTAT
GCAACCACAC ATTTACGCAC ATAGGATAGC AAAATCATGT AGGAGTACTA AATATGATGA ACCGTGTATC TTTATTTCAA
AGGAGAATTG GACTTGAAAT TCACAACCTT GTGCTACTAT ATTGGGCAAT TCTTTTTAGT CATACAGGTA GCTCTTATTT
ATATTATGAT TTCGTTGGTT GAATTGTGTC AGGTGTTGCC GGATATGTGC AATTTGTTCC TTTTGCAAGA GTTCCAGTTC
TTCAGTATGT GAGCAACACC TTCGGAATTT CCTGCGATAT ATCTGTGAAC AACTACCCTG GTCGAATTAA ATCCAAAATC
TTCTGCTGGA TCAGTTCTTT AGATGTGCGT TTTGGTGATA TGGTTTTACT GGTAAGACTA GGTAACTAGT AGAGAGTTTC
TTGCTGCCCC ATCATTTTGT TGGAAAGCCC AAGGTTCAAA CTATGTTTTC TTGCAGATCA AAGAATGGGC GAAAGCTCAA
AACATTAATG ATCCCAAAAC TGGGACCTTA AACTCCTATT CACTTTGCCT ACTAGTCCTC TTCCATTTTC AGGTAATATT
CATCTGTGGT ATTTCAAGTT ATACTGATAC ATGATTTTAG GAATATCCTT GTTACTGTCT TTACCTTATT CCAGACATGT
GAGCCTGCAA TCCTTCCACC TCTTAAGGAG ATTTATGAAG GGAACATTGA AGAAGGTATT GCTGGTAAAA TGAACTAATA
TTTTCTTTGA TGATGATTGT CTAGCATATC TGTATCTGAA TTCATTGCAT TTACATACAG AAATGACGGT GTATGATGAG
GAACATCTTG ATGAGGTTTG CTCTGAAAAT TTAGCAAAAT TTCAAAGCAA GAACAAGGAA CGAAGGAATG AAAGCTCTCT
TTGCCATCTG CTTGCAACCT TTTTCCACAA AGTAATTAAA CAGTATGCTC CGTTTCATTG GTAAAGTTAG TATGCTTCTT
GTAAGGACAT ATTTGCTGTT CATGTCTTGG CGAAGCATGT CTTCATGTTT CTAGGAATAT TTCCTATGCC ATATTTTAGT
AAGTTATATC GAGGTTGCTG GTGCTCATGT AGTTTAATAA GTTGAGTTAT TTCAAAAGTC TTTGGCCCTT GCTTTTGTTC
AGCATCGTGG CATCTTGTTA AACTCAAACA TACCTTTTCT CTTTGTGTTT TGTATTTTTT AAACTAATTA ACACTTGACA
GACTCTTCCT TTTAGAGAAG TAAGACGATT TTTGTTATAA CTCAACTCAT CTTCCATGCT AGCCTTTGTT TTGCTCATTT
TGTTATAAGT CCAATAAGAT GATTTGTGTT CAAATCTAAG CTAAGTGAAA TAGCTACTTA TCTTCCTTTC ATTAAACATA
ATTAAACAAA TGAGCTAATC CCTCCTTTTT GTGGGGCTAC TTAATTACTT TGCTCCATTA AACTATATTT TATCCCCATT
AAAATAATGC TACTGTCACT GAAAGCATAT TTAAGATTTA GATGCCATGC ACATTTTTCA TTCGTTACTT TTTGTAACTC
ATGAGATACG AGCTTTACCA GTAATCTTAC ATTGATTGCA GTTTTCCTCT ATCGGCACCC TTTCGGGTGA TGTGATATCC
ACTTACACGG GCCAGTTCAA ACGAATAGAG GAGAACCCAA GTTGGATGGC CAGATCATAC AGCTTATTTG TAAGGATTTC
CTTTTATGGT TGCATTCAGC AGTCTTATTG AAATTTGGAC TATTTACTAA CACAATCTCG TTCGTTCATT ATCTCCTTTT
CAGGTCAAAG ATCCAATTGA GAGACCTGAT AATGCCGCTA GAGCGGTTGA TTTGAAAGGC CTTGAGCGGA TTGCTGGGGC
CTTCACCGCT GCTAATCGTA AGTTTGCATC TCTCCAACAC GCCAAACGAA ATGACTTACT GGAGATGCTG TGTACGCCTG
CTGTTGGCTC AAAGCTTGGC ATAAGAGTTA GCCAAGAAGT TATGGCTAAC TCTTGCACAA ATACTCCACG GAGGAACCGT
CATCATGGTA GACCAACGGA ACAAGTCTCA GCGAGGCCAT CTGATAATCA AAATCACCGC GGGGCCAGAG AATTTACAGT
TGGGAGACAA GTTCATAATC CCCCACGGGC GCGCCAATCA ACTGGAGCGT ACCATGCTCT TAACAGTCAG CATGTAATTC
CTGCATTGAG CCAACCAGCA GGAATTTATC AAACAGTTGG CCCATACCAG AGTAATGGTC ATCCACAGGT GTATACTAGA
GATGTCCAAA CAGTAGGGCA CCAAAATTAT AGGCATCCAA TGGGACACAA CACACAGCTC CAAACAGTGG AACCATATCA
GAGTAATAAT AGTCAACCAC AGGTTCATGC TACCAGCATC CAAGCACCAA GACAATACCA GAATTATACT CGATAACGCC
CGGCCAGAAA CTACAATCAC CAAGTGTTAC ATGCTACAGC GACCGAGACA ACGGCCAGAA ACTACAATCA CCAATTGTTA
CATGCTGCAG CAACCGAGAC AACGGCCAGA AACTATAATC ACCAATCGTT ACATGCTACA GCAACCGAGA CAGAAGGATC
ATACCGGAAT CAGCAGCAGA GACAACACAC ATCTGGCCGT CAAACAAATA GGAACGCTGT GAACACAAGG TACGTGCCTG
TTGTTGGAAG GCCACAAAAT GTAGCATGTG AATCACGAGC TCAAGACTCC TCAGGCAGGG GAACATGGCA ACAAAGGGAG
CCGCGAGCAG GATCAACCTA CCAAAATAGA TAGCAACGGA TTATCTTCAG CTTTTGCATC GCAGTGTGTA TGAGTTTTTG
GTAGTTTGTG ATAGCTTTCG TCAGCCAGCA GTTTGATCTC AGTGCCGCTG CAATGCAGCG AACTGTATTG GGTAAAATGC
AGTTACAAGA TTTTCTTTTG TGC