Os01t0847200-01

Locus

Os01g0847200

Description

Similar to Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMPG1, MPG1, OsVTC1-1, VTC1-1

Oryzabase Gene Name Synonym(s)

mannose-1-phosphate guanyl transferase 1

Transcript Evidence

AK122126 (DDBJ, Best hit)

Protein Evidence

Q09PG3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: transferase activity (GO:0016740)

Molecular Function: nucleotidyltransferase activity (GO:0016779)

Functional domain (InterPro)

Bacterial transferase hexapeptide repeat (IPR001451)

Nucleotidyl transferase (IPR005835)

Hexapeptide transferase, conserved site (IPR018357)

Full-length cDNA

J033132D02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0847200-01)

RiceXPro (AK122126)

Others

Oryzabase (11515)

KEGG (Os01t0847200-01 (EC:2.7.7.13))

Transcript

1706 bp

>Os01t0847200-01 Similar to Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
GAATTCTGAAAGCCTGAACCTCTCGTCGTGTCTCGTACTCTCGTTCCCCTCCCCTCGCGT
CGCCTCTCCACTTCGTCTCTATAAAGTCCCACCCAATTCTCGATTCCCAATCCAGCGCAG
CACAAAGCCCTCCTCCTTCCACCGCAGCTGCGCTACCTACCTCCAAGAGGGCTGGTCCGC
TGGTCGTGGAGAAGGAAGAGAGATCTTCCAGGCTGATCCCTCCTATTGCTTTCTCCTTCC
CGAGCCCGCTTGAGGATCCCCGCCGGAGTAGGGATTAGGGAGGGGAGAACAGGAGGCGGC
GATTCACCATGAAGGCGCTCATTCTTGTTGGAGGCTTCGGCACTCGCCTTCGGCCTTTGA
CGCTCAGTTTCCCAAAGCCTCTTGTTGATTTCGCGAACAAGCCCATGATTCTGCATCAGA
TTGAGGCCTTGAAAGAAGTTGGAGTAACAGAAGTTGTTTTAGCCATCAACTACCGACCGG
AGGTAATGCTCAATTTCCTGAAGGACTTTGAGGATAAGCTTGGCATCACAATCACGTGTT
CCCAAGAGACTGAGCCCTTGGGAACTGCTGGCCCTCTTGCTCTAGCAAGGGACAAGCTTG
TGGATGGATCTGGTGAGCCATTCTTTGTCCTCAACAGTGACGTCATAAGTGAATACCCTT
TTGCTGAGCTCATAAAATTTCACAAGAGCCATGGTGGTGAGGCAACGATTATGGTCACCA
AGGTGGACGAACCATCAAAATATGGTGTTGTGGTTATGGAGGAGGTCACTGGAATGGTGG
AAAAATTTGTTGAGAAACCAAAAATATTTGTAGGCAACAAGATCAATGCGGGAATTTACT
TGTTGAATCCATCTGTCCTGGACCGCATCGAGCTGAAGCCAACTTCAATTGAGAAAGAGG
TCTTTCCTCGAATTGCATCTGATGCAAAGCTCTTTGCTCTGGTCCTTCCAGGTTTTTGGA
TGGATGTTGGCCAACCAAGGGATTACATTACAGGCTTGCGCCTTTATCTGGATTCACTTA
GGAAGAGATCAACCAACAGGTTAGCCACTGGAGCACACATTGTTGGGAATGTGCTAGTTC
ACGAGAGTGCCAAGATTGGCGAAGGCTGTCTGATTGGTCCTGATGTTGCTATCGGTCCTG
GATGCGTCGTGGAGGATGGTGTGAGGCTTTCCCGTTGCACGGTGATGCGTGGCGTGCACA
TTAAGAAGCATGCTTGCATATCAAACAGCATTATTGGATGGCACTCAACTGTTGGACAAT
GGGCACGGATAGAAAATATGACTATCCTGGGAGAGGACGTACATGTAGGTGATGAGGTCT
ATACCAACGGCGGTGTTGTTCTCCCGCACAAAGAGATCAAGTCAAGCATCCTGAAGCCTG
AGATTGTCATGTGAACTAACCCTCCTTTTATGTTATGGTATACTCAAGTTCTTTTAATGC
AGTATCTTTAGTTTATACCTGTGATCCTTCCAAGATGTTGACCTAGCATGTGTGTTACTC
ACATTCTGAAAACTGCTTCTCAATGAGAATTCAGTGTGCCATATTTGATTGTACCTTCAT
TTGGACCATCCAGTAAAGTTCTCAACCCTGCACCAAGAGGACCAGAAGAAACTCTTTTTC
CTATAAAAGAAGAGGATCAGCCTTGTACTTTGTTCTTTTTGAAACAAATATATACTGCTA
TATGGAACAGACCCATGATGTATTGC

CDS

1086 bp

>Os01t0847200-01 Similar to Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
ATGAAGGCGCTCATTCTTGTTGGAGGCTTCGGCACTCGCCTTCGGCCTTTGACGCTCAGT
TTCCCAAAGCCTCTTGTTGATTTCGCGAACAAGCCCATGATTCTGCATCAGATTGAGGCC
TTGAAAGAAGTTGGAGTAACAGAAGTTGTTTTAGCCATCAACTACCGACCGGAGGTAATG
CTCAATTTCCTGAAGGACTTTGAGGATAAGCTTGGCATCACAATCACGTGTTCCCAAGAG
ACTGAGCCCTTGGGAACTGCTGGCCCTCTTGCTCTAGCAAGGGACAAGCTTGTGGATGGA
TCTGGTGAGCCATTCTTTGTCCTCAACAGTGACGTCATAAGTGAATACCCTTTTGCTGAG
CTCATAAAATTTCACAAGAGCCATGGTGGTGAGGCAACGATTATGGTCACCAAGGTGGAC
GAACCATCAAAATATGGTGTTGTGGTTATGGAGGAGGTCACTGGAATGGTGGAAAAATTT
GTTGAGAAACCAAAAATATTTGTAGGCAACAAGATCAATGCGGGAATTTACTTGTTGAAT
CCATCTGTCCTGGACCGCATCGAGCTGAAGCCAACTTCAATTGAGAAAGAGGTCTTTCCT
CGAATTGCATCTGATGCAAAGCTCTTTGCTCTGGTCCTTCCAGGTTTTTGGATGGATGTT
GGCCAACCAAGGGATTACATTACAGGCTTGCGCCTTTATCTGGATTCACTTAGGAAGAGA
TCAACCAACAGGTTAGCCACTGGAGCACACATTGTTGGGAATGTGCTAGTTCACGAGAGT
GCCAAGATTGGCGAAGGCTGTCTGATTGGTCCTGATGTTGCTATCGGTCCTGGATGCGTC
GTGGAGGATGGTGTGAGGCTTTCCCGTTGCACGGTGATGCGTGGCGTGCACATTAAGAAG
CATGCTTGCATATCAAACAGCATTATTGGATGGCACTCAACTGTTGGACAATGGGCACGG
ATAGAAAATATGACTATCCTGGGAGAGGACGTACATGTAGGTGATGAGGTCTATACCAAC
GGCGGTGTTGTTCTCCCGCACAAAGAGATCAAGTCAAGCATCCTGAAGCCTGAGATTGTC
ATGTGA

Protein

362 aa

>Os01t0847200-01 Similar to Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM
LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE
LIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTGMVEKFVEKPKIFVGNKINAGIYLLN
PSVLDRIELKPTSIEKEVFPRIASDAKLFALVLPGFWMDVGQPRDYITGLRLYLDSLRKR
STNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGVHIKK
HACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVVLPHKEIKSSILKPEIV
M*

5'UTR

chr01:36395486..36395713 (+ strand) : 228 bp

chr01:36395840..36395919 (+ strand) : 80 bp

CDS

chr01:36395920..36396030 (+ strand) : 111 bp

chr01:36396518..36396580 (+ strand) : 63 bp

chr01:36396671..36396910 (+ strand) : 240 bp

chr01:36396986..36397657 (+ strand) : 672 bp

3'UTR

chr01:36397658..36397969 (+ strand) : 312 bp

FASTA

>Os01t0847200-01 class=Sequence position=chr01:36395486..36397969 (+ strand)
GAATTCTGAA AGCCTGAACC TCTCGTCGTG TCTCGTACTC TCGTTCCCCT CCCCTCGCGT CGCCTCTCCA CTTCGTCTCT
ATAAAGTCCC ACCCAATTCT CGATTCCCAA TCCAGCGCAG CACAAAGCCC TCCTCCTTCC ACCGCAGCTG CGCTACCTAC
CTCCAAGAGG GCTGGTCCGC TGGTCGTGGA GAAGGAAGAG AGATCTTCCA GGCTGATCCC TCCTATTGGT ACGGAAGCCC
TAAACTCATC GGAGCTTTGC CGCGGCCGCG AGCGATCAAA TCGAAATCTT TCTTTCTTTG TTCTTTGATG CTCCAACCTA
GTGTCGGATT TGATTTTGAC TGTTGCAATG GCAGCTTTCT CCTTCCCGAG CCCGCTTGAG GATCCCCGCC GGAGTAGGGA
TTAGGGAGGG GAGAACAGGA GGCGGCGATT CACCATGAAG GCGCTCATTC TTGTTGGAGG CTTCGGCACT CGCCTTCGGC
CTTTGACGCT CAGTTTCCCA AAGCCTCTTG TTGATTTCGC GAACAAGCCC ATGATTCTGC ATCAGGTAAT AAGTGGTTTC
GCTAGTACTC TGATGGAGTA ATAAGAGTAC TTATTTGCAG TGCCAATGGA TGAATTGGGC ACAAGTTAAT TATAGTACAG
TATTCTTTAC CAACAGTCCA ACAATGGCAC TGGCCTCTCC ATGAAAGGAG GGAGAGGGTG CTAAACTGGT CAGAGAACAT
TAATACTATT TGATTTGTTT ATTACTCCCA CATAAACATG GTGTAACAAC TAAAAATCCA TGGTAGGTTG CACTTGGATG
TGATTGAATG CACCTTTTTA CTATTCAATT GTTTCTTTCC TTAGTTATCA ATTTGGTTAC ATGATTTTGG AAAACTCTTT
TGGTATCACA CCAAATTTTC TCTGTCCTCG AAAATTCCAA TCGGTTATCA AGAGTACTTG ATTTATATCC AAAATGTTGG
CTCCAGCAAA CATGAGCATG AGGATTGAGG AGAGTAATGA GCTCTGAATT AAAAGTTTTC CGATTTATGC AGATTGAGGC
CTTGAAAGAA GTTGGAGTAA CAGAAGTTGT TTTAGCCATC AACTACCGAC CGGAGGTAAA AAGGAGATAA TCTTTTACTG
TTGTCTCATG GTATAAGTAT AACTAACTTC ACATTCTAAT TGGTTTGCTC TGATCCGTCT TTTAGGTAAT GCTCAATTTC
CTGAAGGACT TTGAGGATAA GCTTGGCATC ACAATCACGT GTTCCCAAGA GACTGAGCCC TTGGGAACTG CTGGCCCTCT
TGCTCTAGCA AGGGACAAGC TTGTGGATGG ATCTGGTGAG CCATTCTTTG TCCTCAACAG TGACGTCATA AGTGAATACC
CTTTTGCTGA GCTCATAAAA TTTCACAAGA GCCATGGTGG TGAGGCAACG ATTATGGTCA CCAAGGTAGA TCCTTTCTTT
GACCACTCTC TTGAATTGTA AACTTGTGTA CTGTGTATAC TGACTATTAT TTCAATATAG GTGGACGAAC CATCAAAATA
TGGTGTTGTG GTTATGGAGG AGGTCACTGG AATGGTGGAA AAATTTGTTG AGAAACCAAA AATATTTGTA GGCAACAAGA
TCAATGCGGG AATTTACTTG TTGAATCCAT CTGTCCTGGA CCGCATCGAG CTGAAGCCAA CTTCAATTGA GAAAGAGGTC
TTTCCTCGAA TTGCATCTGA TGCAAAGCTC TTTGCTCTGG TCCTTCCAGG TTTTTGGATG GATGTTGGCC AACCAAGGGA
TTACATTACA GGCTTGCGCC TTTATCTGGA TTCACTTAGG AAGAGATCAA CCAACAGGTT AGCCACTGGA GCACACATTG
TTGGGAATGT GCTAGTTCAC GAGAGTGCCA AGATTGGCGA AGGCTGTCTG ATTGGTCCTG ATGTTGCTAT CGGTCCTGGA
TGCGTCGTGG AGGATGGTGT GAGGCTTTCC CGTTGCACGG TGATGCGTGG CGTGCACATT AAGAAGCATG CTTGCATATC
AAACAGCATT ATTGGATGGC ACTCAACTGT TGGACAATGG GCACGGATAG AAAATATGAC TATCCTGGGA GAGGACGTAC
ATGTAGGTGA TGAGGTCTAT ACCAACGGCG GTGTTGTTCT CCCGCACAAA GAGATCAAGT CAAGCATCCT GAAGCCTGAG
ATTGTCATGT GAACTAACCC TCCTTTTATG TTATGGTATA CTCAAGTTCT TTTAATGCAG TATCTTTAGT TTATACCTGT
GATCCTTCCA AGATGTTGAC CTAGCATGTG TGTTACTCAC ATTCTGAAAA CTGCTTCTCA ATGAGAATTC AGTGTGCCAT
ATTTGATTGT ACCTTCATTT GGACCATCCA GTAAAGTTCT CAACCCTGCA CCAAGAGGAC CAGAAGAAAC TCTTTTTCCT
ATAAAAGAAG AGGATCAGCC TTGTACTTTG TTCTTTTTGA AACAAATATA TACTGCTATA TGGAACAGAC CCATGATGTA
TTGC